KEGG   Aspergillus niger: ANI_1_1216074Help
Entry
ANI_1_1216074     CDS       T01030                                 

Gene name
An08g08840
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ang  Aspergillus niger
Pathway
ang00250  Alanine, aspartate and glutamate metabolism
ang00410  beta-Alanine metabolism
ang00430  Taurine and hypotaurine metabolism
ang00650  Butanoate metabolism
ang01100  Metabolic pathways
ang01110  Biosynthesis of secondary metabolites
Module
ang_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ang00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ANI_1_1216074 (An08g08840)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ANI_1_1216074 (An08g08840)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ANI_1_1216074 (An08g08840)
   00430 Taurine and hypotaurine metabolism
    ANI_1_1216074 (An08g08840)
Enzymes [BR:ang01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     ANI_1_1216074 (An08g08840)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 4983202
NCBI-ProteinID: XP_001392995
UniProt: A5AB29
LinkDB All DBs
AA seq 515 aa AA seqDB search
MVHLAQVKRDSDVEKTAQQVGSIQLDSAEDDAFYSSVYGTRFATEQLPSTEMPEREMPRE
VAYRMIKDELSLDGNPMLNLASFVTTYMEEEVEKLMTESFSKNFIDYEEYPQSAEIQNRC
VNMIARLFNAPTDSDDEHPMGTSTIGSSEAIMLGTLAMKRRWQNKRRAEGKDASKPNIVM
NSAVQVCWEKAARYFDVEERYVYCTEDRYVIDPKQAVDLVDENTIGICAILGTTYTGEYE
DVKAINDLLVERGIDCPIHVDAASGGFVAPFVAPNLEWDFRLSKVVSINVSGHKYGLVYP
GVGWVVWRSPEYLPKELIFNINYLGAEQASFTLNFSKGASQVIGQYYQMIRLGKRGYRSI
MTNITRTADYLADQLEQLGFVIMSERRGKGLPLVAFRLPADRDSEQFDEFALAHQLRERG
WIVPAYTMAPNSNSLKLMRVVVREDFSKNRCDALLADIKLALKTLSDMDKAMLERYTHHV
RVHSTNSHKSKHVHPHYKNESHSLQGKHGKTHGVC
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggtccatcttgctcaggttaagcgcgacagtgatgtcgagaagaccgctcaacaggtc
ggctccatccagctggactctgctgaggacgatgccttttactccagcgtctacggcact
cgttttgctacggagcagctcccctcgactgagatgccggagcgggagatgccccgtgag
gtggcctaccgtatgatcaaggatgagctcagtctggatggtaaccccatgctcaacctt
gcgagtttcgtgacaacctacatggaagaggaagttgagaagctcatgaccgagtccttc
agcaagaacttcatcgactacgaggaatacccccaatccgctgagatccagaaccgctgt
gtgaacatgatcgcccgtctgttcaacgctcccaccgacagtgatgacgaacaccccatg
ggtacctctaccatcggttcatccgaggccatcatgctgggcaccttggccatgaagaga
cggtggcagaacaagcgcagggcggagggcaaggatgcctccaagcccaacattgtcatg
aacagtgccgtccaggtgtgctgggagaaggccgcccgctacttcgatgttgaggagcgc
tacgtctactgcacggaagaccgctacgtcattgatcccaagcaggccgtggacctggtg
gacgagaacaccattggtatctgtgccatcctgggcaccacctacaccggtgagtacgag
gacgtcaaggccatcaacgacctccttgtcgagcggggcattgactgccccatccacgtc
gatgccgccagtggtggtttcgtcgctcccttcgttgcccccaacctggagtgggacttc
cgtctgtccaaggtggtgtccatcaacgtgtctggtcacaagtacgggttggtgtacccc
ggtgttggttgggttgtctggcgctcgcccgagtacctgcccaaggagctgatcttcaac
atcaactacctgggagccgagcaggccagcttcacgctgaacttctccaagggcgcgtcg
caggtcattggacagtactaccagatgatccgactgggcaagcggggctaccggtcgatc
atgacgaacatcacacgcactgccgactacttagccgaccagctggagcagctgggcttt
gtgatcatgagcgagcgtcgcggcaagggcctgccgctggtggcgttccggctgccggcg
gaccgcgactcggagcagtttgacgagtttgcgctggcgcaccagctgcgtgagcgtggg
tggatcgtcccggcctacacgatggcgcccaacagcaactcgctgaagctgatgcgggtg
gtggtgcgcgaggactttagcaagaaccggtgcgatgcgctgctggcggacattaagctg
gccttgaagacgctcagcgacatggacaaggcgatgttggagcggtacactcatcatgtc
cgggtgcactcgaccaactcgcacaagtctaagcatgtgcaccctcactacaagaacgag
agccattccttgcagggcaagcatggcaagacccacggtgtgtgttaa

DBGET integrated database retrieval system