KEGG   Aspergillus niger: ANI_1_1476014Help
Entry
ANI_1_1476014     CDS       T01030                                 

Gene name
An01g10930
Definition
(RefSeq) alpha/beta-glucosidase agdC
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
ang  Aspergillus niger
Pathway
ang00052  Galactose metabolism
ang00500  Starch and sucrose metabolism
ang01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ang00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    ANI_1_1476014 (An01g10930)
   00500 Starch and sucrose metabolism
    ANI_1_1476014 (An01g10930)
Enzymes [BR:ang01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     ANI_1_1476014 (An01g10930)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 4977533
NCBI-ProteinID: XP_001389510
LinkDB All DBs
AA seq 866 aa AA seqDB search
MLGSLLLLLPLVGAAVIGPRANSQSCPGYKASNVQKQARSLTADLTLAGTPCNSYGKDLE
DLKLLVEYQTDERLHVMIYDADEEVYQVPESVLPRVGSDEDSEDSVLEFDYVEEPFSFTI
SKGDEVLFDSSASPLVFQSQYVNLRTWLPDDPYVYGLGEHSDPMRLPTYNYTRTLWNRDA
YGTPNNTNLYGSHPVYYDHRGKSGTYGVFLLNSNGMDIKINQTTDGKQYLEYNLLGGVLD
FYFFYGEDPKQASMEYSKIVGLPAMQSYWTFGFHQCRYGYRDVYELAEVVYNYSQAKIPL
ETMWTDIDYMDKRRVFTLDPQRFPLEKMRELVTYLHNHDQHYIVMVDPAVSVSNNTAYIT
GVRDDVFLHNQNGSLYEGAVWPGVTVFPDWFNEGTQDYWTAQFQQFFDPKSGVDIDALWI
DMNEASNFCPYPCLDPAAYAISADLPPAAPPVRPSSPIPLPGFPADFQPSSKRSVKRAQG
DKGKKVGLPNRNLTDPPYTIRNAAGVLSMSTIETDLIHAGEGYAEYDTHNLYGTMMSSAS
RTAMQARRPDVRPLVITRSTFAGAGAHVGHWLGDNFSDWVHYRISIAQILSFASMFQIPM
VGADVCGFGSNTTEELCARWASLGAFYTFYRNHNELGDISQEFYRWPTVAESARKAIDIR
YKLLDYIYTALHRQSQTGEPFLQPQFYLYPEDSNTFANDRQFFYGDALLVSPVLNEGSTS
VDAYFPDDIFYDWYTGAVVRGHGENITLSNINITHIPLHIRGGNIIPVRTSSGMTTTEVR
KQGFELIIAPDLDDTASGSLYLDDGDSLNPSSVTELEFTYSKGELHVKGTFGQKAVPKVE
KCTLLGKSARTFKGFALDAPVNFKLK
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atgttggggtctttgcttttactcttaccccttgtgggcgctgctgtcattggacccagg
gcaaacagtcagagttgcccagggtataaggcgtccaacgtccaaaagcaggctaggtca
ctgactgcggatctgactctagctggtacgccttgtaatagctatggcaaggatttggaa
gacctcaagctgcttgtggaatatcagactgatgaacggttacatgttatgatctacgat
gccgacgaggaagtctatcaagttcctgaatcagtccttcctcgcgtgggtagtgacgag
gactctgaggacagtgttttggaatttgactatgtggaagaaccgttttcattcaccatc
tccaagggagatgaggtcctgtttgactcttcggcatcaccactagtttttcagtcgcaa
tatgtgaaccttcgcacctggttgcccgatgatccctatgtgtatggtctcggagagcat
tctgaccctatgcgcttgccaacatacaattacacgcggaccctttggaaccgcgacgcg
tatggcactccaaacaacaccaacttgtacggtagtcatcctgtctactatgatcaccgt
ggaaagtccggaacttatggagtcttcctgctgaactctaatggtatggacatcaagatc
aaccaaacgacagatggaaagcagtacttggaatacaatcttctcggcggtgttctggac
ttctacttcttctacggagaagatcctaagcaagcgagcatggaatactcaaagattgtc
ggtctcccggcaatgcagagttactggactttcggcttccatcaatgccgttatggatac
cgcgatgtgtatgaacttgccgaggtggtctacaactacagccaggcaaagattcctctg
gagacgatgtggacagatatcgactacatggacaagagaagggtgtttacccttgatcct
cagaggttcccgctcgaaaagatgcgggagttggtaacctacctgcacaatcatgatcag
cattacattgtcatggttgacccggctgtgagcgtaagcaataacacggcatatatcacc
ggcgtgagagacgatgttttccttcacaatcagaacggtagcctatacgagggtgctgtt
tggcctggtgtcactgttttcccagactggttcaatgagggtactcaggattactggact
gcgcaatttcaacagttctttgatcccaagtccggagtcgatattgacgccctgtggatt
gacatgaacgaagcctccaatttctgcccttatccttgtctggacccagcggcatacgcg
atctccgccgacctcccaccggcagcaccacctgttcggccaagcagcccgatcccactg
cccggattccccgcggactttcagccttcgtctaagcgatctgttaaaagagcgcaagga
gataaagggaagaaggttgggttgcccaatcgcaacctcactgacccgccctacaccatt
cggaatgccgcaggtgtccttagtatgagcactatcgagacggatctcattcatgcgggt
gaagggtatgccgagtatgatactcacaatctctatggaacaatgatgagctctgcttcc
cgcacggctatgcaggcccgccgtcccgatgtgaggcctttggtcatcactcgcagtacg
tttgcaggcgctggagcacacgtaggacactggctgggcgacaactttagcgattgggtt
cactaccggatctccatcgcgcagatcctctccttcgcgtccatgttccagattccaatg
gtcggggctgacgtgtgtgggtttggtagcaacacgacggaggaattgtgtgcccgatgg
gcgtcacttggtgccttctatacgttctaccgcaatcataacgagctgggcgacatatcg
caagagttctaccgctggcctacggttgccgagtccgcgcgtaaggccattgacatccgg
tacaagctcctcgattatatctacactgctcttcaccggcaaagccagaccggcgagcca
ttcctgcagcctcaattctacctgtaccctgaggattcgaacacctttgcgaacgaccgg
cagttcttctatggtgacgcccttcttgtcagccccgtgttgaatgagggatccacctca
gtcgacgcatacttcccggacgacatcttctacgattggtacacaggggcagtggtgcgt
gggcacggagaaaacatcacgctcagcaacatcaacatcacccacatccctctgcacatc
cgcggtggaaatatcatacctgtcaggacatccagcggcatgacaaccactgaggttcgt
aagcagggcttcgagctgatcatcgcgccagacttggatgacaccgcatcgggcagtcta
tatttggatgatggagactcgttgaacccgtcatctgtgacagagctcgagttcacgtac
agcaaaggggagttgcacgtgaagggtacattcggacagaaggccgtccccaaggtggag
aaatgtaccttgctggggaagtcagcacggacgttcaagggctttgcactcgatgcgccg
gtgaactttaagctgaagtag

DBGET integrated database retrieval system