KEGG   Aspergillus niger: ANI_1_1984024Help
Entry
ANI_1_1984024     CDS       T01030                                 

Gene name
An02g14380
Definition
(RefSeq) hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ang  Aspergillus niger
Pathway
ang00010  Glycolysis / Gluconeogenesis
ang00051  Fructose and mannose metabolism
ang00052  Galactose metabolism
ang00500  Starch and sucrose metabolism
ang00520  Amino sugar and nucleotide sugar metabolism
ang01100  Metabolic pathways
ang01110  Biosynthesis of secondary metabolites
ang01130  Biosynthesis of antibiotics
ang01200  Carbon metabolism
Module
ang_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ang_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANI_1_1984024 (An02g14380)
   00051 Fructose and mannose metabolism
    ANI_1_1984024 (An02g14380)
   00052 Galactose metabolism
    ANI_1_1984024 (An02g14380)
   00500 Starch and sucrose metabolism
    ANI_1_1984024 (An02g14380)
   00520 Amino sugar and nucleotide sugar metabolism
    ANI_1_1984024 (An02g14380)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    ANI_1_1984024 (An02g14380)
Enzymes [BR:ang01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     ANI_1_1984024 (An02g14380)
Membrane trafficking [BR:ang04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    ANI_1_1984024 (An02g14380)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 4979978
NCBI-ProteinID: XP_001400569
UniProt: A2QFF8
LinkDB All DBs
AA seq 490 aa AA seqDB search
MVGIGPKRPPSRKGSMADVPQNLLQQIKDFEDQFTVDRSKLKQIVNHFVKELEKGLSVEG
GNIPMNVTWVLGFPDGDEQGTFLALDMGGTNLRVCEITLTQEKGAFDITQSKYRMPEELK
TGTAEELWEYIADCLQQFIESHHENEKISKLPLGFTFSYPATQDYIDHGVLQRWTKGFDI
DGVEGHDVVPPLEAILQKRGLPIKVAALINDTTGTLIASSYTDSDMKIGCIFGTGVNAAY
MENAGSIPKLAHMNLPADMPVAINCEYGAFDNEHIVLPLTKYDHIIDRDSPRPGQQAFEK
MTAGLYLGEIFRLALMDLVENRPGLIFNGQDTTKLRKPYILDASFLAAIEEDPYENLEET
EELMERELNIKATPAELEMIRRLAELIGTRAARLSACGVAAICTKKKIDSCHVGADGSVF
TKYPHFKARGAKALREILDWAPEEQDKVTIMAAEDGSGVGAALIAALTLKRVKAGNLAGI
RNMADMKTLL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggttggaatcggtcctaagcgtcccccctcccgcaagggttccatggccgatgttccc
cagaacctcttgcagcagatcaaggacttcgaggaccaattcaccgtcgatcgctccaag
ctcaagcagattgtcaaccactttgtcaaggaattggaaaagggtctctctgtcgagggt
ggaaacatccctatgaacgtcacctgggttctgggattccccgatggcgacgaacagggt
actttcctcgccctcgacatgggtggcaccaacctgcgtgtttgtgagatcaccctgacc
caggagaagggtgccttcgacatcacccagtccaagtaccgcatgcccgaggaattgaag
accggtaccgccgaggagctgtgggaatacatcgccgactgcctgcagcaattcatcgag
tcccaccacgagaacgagaagatctccaagctgcccctgggtttcaccttctcctacccc
gccacccaggattacatcgaccacggtgtcctgcagcgctggaccaagggtttcgacatt
gatggtgtcgagggccacgacgtcgtcccgccgttggaggccatcctgcagaagcgcggc
ctgcccatcaaggtggctgcactgatcaacgacaccaccggaaccctcatcgcctcttct
tacaccgactccgacatgaagatcggctgcatcttcggtaccggtgtcaacgccgcctac
atggagaacgccggctccatccccaagctggctcacatgaacctgcccgccgacatgccc
gtggctatcaactgcgagtacggtgctttcgacaacgagcacatcgtgctgcctctgacc
aagtacgaccacatcatcgaccgcgactcgccccgtcccggtcagcaggccttcgagaag
atgaccgccggtctgtacctgggtgagatcttccgtctggccctgatggacctggtggag
aaccgccccggcctcatcttcaacggccaggacaccaccaagctgcgcaagccctacatc
ctggatgcctccttcctggcagccatcgaggaggacccctacgagaacctggaggagacc
gaggagctcatggagcgcgagctcaacatcaaggccaccccggcggagctggagatgatc
cgccgcctggccgagctgatcggtacgcgtgccgctcgcctgtcggcctgcggtgttgcc
gccatttgcacgaagaagaagatcgactcgtgccacgttggtgccgacggctccgtcttc
accaagtaccctcacttcaaggcgcgcggagccaaggctctgcgcgagatcctggactgg
gctccggaggagcaggacaaggtgaccatcatggcggccgaggatggatctggtgtggga
gctgcgctgattgcggcgctgaccctgaagcgggtcaaggccggcaacctggccggtatc
cgaaacatggctgacatgaagaccctgctataa

DBGET integrated database retrieval system