KEGG   Aspergillus niger: ANI_1_2692014Help
Entry
ANI_1_2692014     CDS       T01030                                 

Gene name
An01g07110
Definition
(RefSeq) glutathione transferase
Organism
ang  Aspergillus niger
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C_2 GST_N GST_C_5 GST_C_3 BBS2_C
Motif
Other DBs
NCBI-GeneID: 4978162
NCBI-ProteinID: XP_001389135
LinkDB All DBs
AA seq 584 aa AA seqDB search
MDHPSLSSEVDTTIHSTASTLLHPSLTSVAEDASTLAAHQDPQLVPTHRQGQVSIDEDSL
HGLQCAVEELDYSRQSHQSQNQHLHQQTHLQSLVKRPDQHVDIRTILDPPDLDAWRERLF
NVDEMIVLSEEQFLTYFPHIDNVYSHRSTQHYKRKPLISHYWDCRLKGRPPGTPKSNDPN
KKKRKRTARQRDLCDVKIKITEYFPGHDVMGSDLGVLDGLGVPSPVLQESAVREQQQAQN
QQFGLLTPSLNPPLPEGHPGVNGQRFFTIQRVNGNGANGKNDGVSGGHRHTLEDSDRVKK
NSVQRFLLQELKEKKRSLNTRVMATQNQIQKQYHTKATGLAAQTVAHRSQDNELKLYGSC
FCPFVQRVWVGLEIKGIPYQYIEVDPYKKPQSLLDVNPRGLVPALRHGDWGSYESSVLLE
YLEDLNVGTPLLPPGDAKLRAHCRLWTDFINRYIVPNFYRVLQEQDTHKQITNAQELRDA
FNTLVGAADAQGPFFLGAQISFVDVQVAPWIIRLRRALKPYRGWPDPEPGSRWGAWVDAI
ENNEHIQATTSTDELYLDSYERYAQNRPNTSQVANAINSGRGLP
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggaccatccatccctttcctccgaagttgatacaacaatacactctacagcctcgact
ctccttcatccctctcttacttctgtcgccgaagatgcgtcgacgctagctgcccaccag
gacccgcaactagttccaacccatcgacaaggccaagttagcattgacgaggactcgctc
catggtctacaatgtgccgtcgaagagctcgactactctcgacaatctcatcagtctcaa
aatcaacaccttcatcaacagacgcatcttcaatctctcgtaaaaagacctgaccagcat
gtcgacatccgcacgattctcgatccgccggatctcgacgcatggcgagaacggcttttc
aatgtcgacgagatgatagtcctaagtgaggagcaattcctaacatatttcccacacatt
gacaacgtctactcccaccgctcaactcaacactacaaacgcaaaccactaatttcccat
tactgggactgtcgcctgaaaggtcgacctcccggaacaccgaaatccaacgatcccaac
aaaaagaaacgtaaacgaactgcccgtcagcgggatctctgtgatgtgaagatcaagatc
acagaatacttcccgggccacgatgttatgggatcagatcttggagtccttgatgggctt
ggggttcctagcccagtactccaggagtctgctgtcagggagcaacaacaagctcaaaac
cagcagtttggtctactaacgccaagcttgaatccacctctaccagagggtcatccaggg
gtcaacgggcagcggttctttactatccagcgagtaaatgggaatggggcgaacgggaag
aacgatggtgtgagtgggggccatcgtcatacgctggaggacagtgatcgcgtgaagaag
aatagcgtgcagcggttcttattgcaggagttgaaagagaagaagaggtcgctgaatacc
agagtaatggctactcagaaccagattcaaaaacaataccataccaaagccaccggcctg
gctgcccagacagtcgcgcaccgctcacaagacaatgaactgaaattgtatggaagttgc
ttttgcccttttgtacagcgcgtctgggttggcctggagatcaagggcatcccctatcaa
tatattgaggttgacccgtataagaagccccagtcattgctggacgtgaaccccaggggt
cttgtcccagccttgcggcatggggattggggctcatatgagagttccgtattgctggaa
tacttggaggatctgaatgtcggcacaccgttgcttccgcccggagacgccaagctgagg
gcgcattgccgactgtggacggattttatcaaccgctacatcgtcccaaatttctaccgt
gtccttcaagagcaagacacacataagcaaataaccaacgcgcaggagctccgagatgca
ttcaacacattggtcggcgccgcagatgcgcagggcccgttctttctgggcgctcaaatc
tcgttcgttgatgtccaggtcgccccttggatcatccgcttgcgccgtgccttgaagcct
tatcgcgggtggccagacccggagcctggcagtcgctggggagcctgggtcgacgctatt
gagaacaatgagcacatccaggcaaccacgagcaccgatgagctctatctggatagttat
gagcgatacgctcaaaaccgccccaacacgtcccaggttgccaatgcgatcaactccgga
aggggtcttccctag

DBGET integrated database retrieval system