KEGG   Aspergillus niger: ANI_1_2706024Help
Entry
ANI_1_2706024     CDS       T01030                                 

Gene name
An02g07600
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ang  Aspergillus niger
Pathway
ang00020  Citrate cycle (TCA cycle)
ang00190  Oxidative phosphorylation
ang01100  Metabolic pathways
ang01110  Biosynthesis of secondary metabolites
ang01130  Biosynthesis of antibiotics
ang01200  Carbon metabolism
Module
ang_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ang_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ang_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ang00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ANI_1_2706024 (An02g07600)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ANI_1_2706024 (An02g07600)
Enzymes [BR:ang01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ANI_1_2706024 (An02g07600)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA FAD_binding_3 Thi4 HI0933_like DAO
Motif
Other DBs
NCBI-GeneID: 4979249
NCBI-ProteinID: XP_001399893
UniProt: A2QDM2
LinkDB All DBs
AA seq 656 aa AA seqDB search
MYRLSRAFHQRTPLPNPFQTRPFLKRHRPFSTLPRHSSPGPSVSEAPLFDHYYDAIVIGA
GGAGLRAAVGLTESGFRTACITKLFPTRSHTVAAQGGINAALGNMTKDDYRWHMYDTVKG
SDWLGDQDAIHYMTREAPKAIYELENYGMAFSRTEDGRIYQRALGGQSLDYGKGGQAYRT
ACAADRTGHAMLHALYGEALKHDTQFFVEFFALDLLMVDGACVGVICLSLEDGTLHRFFA
RNTVLATGGYGRAYFSCTSAHTSTGDGNAIVARAGLPNQDMEFVQFHPSGIHGAGVLITE
GARGEGGYLLNAHGERFMERYAPTAKDLASRDVVARAMNLEIREGRGCGPDKDHIHLQLS
HLPAELIRSRLPGILETASIFAGIDITRDPIPVVPTVHYCMGGIPTNYKGQVLTSSSHTS
SGTNIPDAEVEPVPGLYAAGECASVSVHGANRLGANSLLDIVVFGRACALHIAETNEPNM
PLHNIPHDDTPPSSLGQDSLSSLSTTLHATGDLPSSSLRHNLQRAMQTDLAVFRTHESLT
TGLSKVIQVQNDFSTRLRTSDRSLIWNSDLVETLELRNLLTCAAQTAMAALCRTESRGSH
AREDFPERDDEGWLKHSWTWQKDEKEEGVRVGYRGVIMKTLDEGDCKSVPPVKRSY
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgcctaagccgagccttccatcaaagaacccccctaccaaatcccttccaaacg
cggccttttctcaagcgacaccgcccattctccactcttccccggcactcatctccggga
ccatctgtatctgaagccccgctattcgaccactactacgatgccatcgtaataggagcc
ggcggcgccggcctccgcgccgcagtcggtctgaccgagtcagggttccgcaccgcatgc
atcacgaaactgttccccacacgctcccacaccgtcgcagcccaaggcggcatcaacgcc
gcgctaggtaacatgacgaaagacgattaccgttggcacatgtacgacacagtcaagggc
tcagactggctaggagaccaagatgcaatccactatatgacaagagaagcgccgaaggct
atatacgagctggagaactacggcatggcgttttccagaacagaagatggtcgcatatac
cagcgggctcttgggggacagagtctcgattatgggaaaggagggcaggcgtatcggacc
gcttgtgcggcggatcggacgggccatgccatgttgcatgctctgtatggggaggcgttg
aagcacgatacccaattcttcgttgaattcttcgcccttgatcttctcatggtcgacggt
gcctgcgttggggtcatctgcctctctcttgaagacggcacgctgcatcgcttttttgcg
cgaaacactgtcctcgcgacgggcggttacggccgggcttacttctcctgcacgtctgca
catacttctaccggagatggtaatgccatagttgcccgcgcgggtcttcctaaccaggat
atggagttcgtgcagttccacccttctgggatccatggcgccggggtgctcatcacggaa
ggtgctcgcggggagggcggatatctcctcaatgcgcacggcgaacgcttcatggagcgg
tatgccccgacagctaaagacctggctagtcgggatgtagtagcaagagccatgaatctt
gagatccgcgagggccggggctgtggcccggataaggatcatatccatctccagctgtct
catttacctgccgagctcattcgttcacgactccctgggattcttgagacggcgtcaatt
ttcgcggggattgacattactcgggatcctattcctgttgttcctacggttcattactgc
atgggcgggataccgacgaactataaaggccaggtgcttactagtagtagccacacttcc
tcggggacaaacatcccagatgcagaggtagaacccgtcccaggcctctacgcagccggc
gaatgtgccagtgtcagcgtgcacggcgccaaccgactcggcgcaaactcgctcctggac
atagttgtcttcggccgggcgtgtgcactccacatcgccgagaccaacgaacccaacatg
ccgcttcacaatatcccacacgatgatactcctccgtcaagcctaggccaagactctcta
tcaagcctatccacgaccctccacgcaacaggcgacctcccgtcttcatcactacgtcac
aacctccaacgagccatgcaaacggacctcgctgtgttccgcacgcacgaatcccttacc
acaggactaagtaaagtgatccaagtgcagaatgatttctccacgcgactcagaacaagc
gatagaagtctaatctggaattcagacctagtagagacactggagttgaggaatctgctg
acgtgcgcggcgcagacggctatggcggcgttgtgtaggacggagagtcgggggagtcat
gcaagggaggatttcccggagagggacgatgagggatggttgaagcatagttggacgtgg
cagaaagacgagaaagaggagggggttcgggtggggtatcggggggtgattatgaagacg
ttggatgagggggattgtaagagtgtgccgccggtgaagaggagctactga

DBGET integrated database retrieval system