KEGG   Aspergillus niger: ANI_1_3136024Help
Entry
ANI_1_3136024     CDS       T01030                                 

Gene name
An02g12430
Definition
(RefSeq) isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ang  Aspergillus niger
Pathway
ang00020  Citrate cycle (TCA cycle)
ang00480  Glutathione metabolism
ang01100  Metabolic pathways
ang01110  Biosynthesis of secondary metabolites
ang01130  Biosynthesis of antibiotics
ang01200  Carbon metabolism
ang01210  2-Oxocarboxylic acid metabolism
ang01230  Biosynthesis of amino acids
ang04146  Peroxisome
Module
ang_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ang_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ang00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ANI_1_3136024 (An02g12430)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ANI_1_3136024 (An02g12430)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    ANI_1_3136024 (An02g12430)
Enzymes [BR:ang01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     ANI_1_3136024 (An02g12430)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 4979780
NCBI-ProteinID: XP_001400371
UniProt: A2QEW0
LinkDB All DBs
AA seq 413 aa AA seqDB search
MATEISKIKVKNPVVELDGDEMTRIIWQEIREKLILPFLDVDLKYYDLGLEYRDQTDDQV
TVEAAEAIKKYGVGVKCATITPDEARVEEFKLKKMWLSPNGTIRNILGGTVFREPIIIXT
IPRLVPGWNKPIIIGRHAFGDQYRATDRVIPGPGKLELVYTPANGEPETVQVYDFQGGGV
AQTQYNTDESIRGFAHASFQMALLKGLPLYMSTKNTILKRYDGRFKDIFQEIYESTYQKD
FEAKNLWYEHRLIDDMVAQMIKSEGGFVMALKNYDGDVQSDIVAQGFGSLGLMTSTLVTP
TGEAFESEAAHGTVTRHYREHQKGRETSTNPIASIFAWTRGLVQRGKLDETPDVVTFAEE
LERACIDVVNEEGIMTKDLALACGRKEREAWVTTREYLAAVERRLKANLKSRL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgaaatctccaagatcaaggtcaagaaccccgtcgttgagctcgacggtgat
gagatgacccgtatcatctggcaggagatcagagaaaagttgattctgcctttccttgac
gtcgacctcaagtactatgacctgggtctcgaataccgtgaccagaccgatgaccaggtc
accgttgaggctgccgaggctatcaagaagtatggtgtcggtgtcaagtgcgccaccatc
actcccgatgaggctcgtgttgaggagttcaagctgaagaagatgtggctgtcccccaac
ggtaccatccgtaacatcctcggcggtaccgtcttccgtgagcccattatcatcnccacc
atcccccgtctcgtccccggctggaacaagcccatcatcatcggtcgtcacgctttcggt
gaccagtaccgtgccaccgaccgtgtcatccccggtcccggcaagctcgagcttgtctac
acccccgccaatggcgagcccgagaccgtccaggtctacgacttccagggtggtggtgtt
gcccagacccagtacaacaccgatgagtcgatccgtggctttgcccacgccagtttccag
atggccctgctcaagggtctccctctgtacatgagcaccaagaacaccatcctcaagcgc
tacgatggtcgcttcaaggacatcttccaggagatctacgagagcacctaccagaaggac
tttgaggccaagaacctctggtacgagcaccgtctcattgacgacatggttgcccagatg
atcaagagtgagggtggattcgtcatggccctgaagaactacgacggtgatgtccagtcc
gacattgtcgcccagggtttcggctcccttggtctgatgacctcgactctggtcacccct
actggcgaggccttcgagtctgaggctgcccacggtaccgtgacccgtcactaccgcgag
caccagaagggccgcgagacctccaccaaccccattgcctccatcttcgcctggacccgc
ggtctggtgcagcgtggcaagctcgacgagactcccgatgttgttacctttgctgaggag
cttgagcgtgcttgcattgacgttgtcaacgaggagggcatcatgaccaaggatctggct
ctggcctgcggccgcaaggagcgtgaggcctgggttactacccgcgagtacctggctgcc
gttgagcgcagactcaaggccaacctcaagtcccgcctctaa

DBGET integrated database retrieval system