KEGG   Aspergillus niger: ANI_1_470064Help
Entry
ANI_1_470064      CDS       T01030                                 

Gene name
An07g03770
Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ang  Aspergillus niger
Pathway
ang04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ang00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    ANI_1_470064 (An07g03770)
Enzymes [BR:ang01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ANI_1_470064 (An07g03770)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 4981643
NCBI-ProteinID: XP_001391459
UniProt: A2QMY6
LinkDB All DBs
AA seq 154 aa AA seqDB search
MVKAVAVIRGDSKVSGTVTFEQANENTPTTISWNITGHDANAERGFHVHQFGDNTNGCTS
AGPHFNPFGKTHGAPEDDERHVGDLGNFKTDAEGNAVGSKQDKLVKLIGAESVLGRTLVV
HAGTDDLGRGGNEESKKTGNAGPRPACGVIGIAA
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaggctgtcgctgttatccgtggagactctaaggtctccggcactgtcactttc
gagcaggccaacgagaacacccccaccaccatctcctggaacatcactggccacgacgcc
aacgctgagcgtggcttccacgtccaccagttcggtgacaacaccaacggctgcacctcc
gctggccctcacttcaaccccttcggcaagacccacggtgctcccgaggacgacgagcgt
cacgtcggtgaccttggcaacttcaagaccgatgccgagggtaacgccgttggttccaag
caggacaagctggtgaagctcatcggtgctgagagcgtcctgggccggaccctggtcgtc
cacgctggtactgatgaccttggccgtggtggcaacgaggagtccaagaagaccggtaac
gctggtcctcgtcccgcttgcggtgtcattggcattgctgcttaa

DBGET integrated database retrieval system