KEGG   Aspergillus niger: ANI_1_594104Help
Entry
ANI_1_594104      CDS       T01030                                 

Gene name
An12g04690
Definition
(RefSeq) DNA ligase Cdc9
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ang  Aspergillus niger
Pathway
ang03030  DNA replication
ang03410  Base excision repair
ang03420  Nucleotide excision repair
ang03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ang00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ANI_1_594104 (An12g04690)
   03410 Base excision repair
    ANI_1_594104 (An12g04690)
   03420 Nucleotide excision repair
    ANI_1_594104 (An12g04690)
   03430 Mismatch repair
    ANI_1_594104 (An12g04690)
Enzymes [BR:ang01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     ANI_1_594104 (An12g04690)
    6.5.1.6  DNA ligase (ATP or NAD+)
     ANI_1_594104 (An12g04690)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     ANI_1_594104 (An12g04690)
DNA replication proteins [BR:ang03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    ANI_1_594104 (An12g04690)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     ANI_1_594104 (An12g04690)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     ANI_1_594104 (An12g04690)
   NER (nucleotide excision repair)
    Other NER factors
     ANI_1_594104 (An12g04690)
   MMR (mismatch exicision repair)
    Other MMR factors
     ANI_1_594104 (An12g04690)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 4985818
NCBI-ProteinID: XP_001395539
LinkDB All DBs
AA seq 894 aa AA seqDB search
MADSRSRKQATLGYVRDSQLTLGRFFGSNSDPKEAPKKQTTLSFSNKKSKSAKKDSESET
AQDPEPVNGHGTSGDANGGADTVDSAIKSKQEAVKADEPVDQNKLKRENSSEDEDSDVQP
VSKRRRKTSRGDEASSSPKRKSPSPKSPKKRSQSRERSPPAVIEKASGEKTPQKELSVSD
DEVAEEEAQSASEDEEKPEVKKKKIEKAQATLKAAGNEPYPDWKAGDPVPYAALCTTFSL
IEMTTKRLVILAHCSLFLRQVLRLTPQDLLPTVQLMINKLAADYAGIELGIGESLIMKAI
GESTGRSLAVIKTDQHEIGDLGLVAAKSRSNQPTMFKPKPLTVRGVHEGLLGIAKVQGHG
SQDKKISGIKKLLSAADAATAGKGSKGIDITKDKGGPSEAKYIVRFLEGKLRLGLAEKTV
LVALAQAVVAHEAAMEGHKTPSAEKLAEGEAILKTVYSELPAYEVIIPAILEHGLSNLPK
VCKLQPGIPLKPMLAKPTKSITEVLDRFEGKEFTCEYKYDGERAQIHYVAPDSIHQYPGA
TATLKKDAKGLSAIFSRNSEDLSKKYPDVLAKLDGWIKEGVQSFVLDCETVAWDTENKKV
LPFQQLMTRKRKDVKAEDVKVKVCIFAFDLLFLNGEPTVKKSLRERRELLHESFQVTEGE
FQFAQYGNTNVLDEIQTLLDDSVKASCEGLMVKMLDTEESGYEPSKRSRNWLKVKKDYLS
GVGDSLDLVVLGAYHGRGKRTSVYGAFLLAAYNSSTQTYETICNIGTGFSEAVLEEFYNA
LSPLTIDRPKPFYSHSNVPKDQPDVWFEPRLVWEVKTADLTLSPRYKAAADEFMGTTGGG
KGVSLRFPRFIKSRDDKKPEQATTTRAVAEMYRKQEAVQKENAGKGGVDDDFEY
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atggcagattcaaggagcaggaagcaagctaccctggggtatgttcgggattcccagttg
actcttgggcgatttttcggctcgaactcagaccccaaagaagctcccaagaagcagact
acgctatcattttcgaacaagaagagcaagtctgccaaaaaagatagtgaatcggaaacg
gcgcaagatccggaacccgtcaatggacatggaactagtggagatgcgaatggtggtgct
gacacggtagactcagccatcaagtcgaagcaagaggctgtcaaggcagacgagcctgtc
gatcagaacaaattgaagagagaaaacagcagtgaggatgaagatagtgatgtccagcct
gtcagcaagcgccgccgcaagacatcccgaggggacgaagcttcctcctctcccaaacga
aaatccccatcacctaaaagccccaagaagcggtcgcagtcaagagagcgctcgccgcca
gctgtcatcgagaaggcatcaggcgagaaaacaccgcaaaaagaattgagcgtctcggat
gacgaagttgcagaagaggaggcacagtctgccagtgaggacgaagagaagcccgaggtg
aagaagaaaaagattgagaaggctcaggctacgttgaaggctgctggaaatgagccttat
ccggattggaaagctggcgacccagttccgtatgccgcgctctgcacgaccttttccctt
atcgagatgaccacgaagcgattagtgatcttggctcattgctctctgttccttcgccaa
gtattgcgactcacaccccaagatcttctccctactgttcaacttatgatcaacaagctg
gccgcggattatgctggaattgaactgggcattggcgagtctttgattatgaaggctatt
ggcgagagtaccggacgtagtctggcagtgattaagacagaccaacatgaaatcggagat
cttggcttggtggccgccaagagtcggtctaaccagccaactatgttcaagccgaagcca
ttgactgttcgcggagtgcacgaaggtctccttggtattgccaaggtccagggccatggt
tcccaggataagaagatttccggtatcaaaaagctgctgtcggcagccgacgcagcaaca
gcaggtaaaggaagcaaaggcattgatatcaccaaggacaaaggcggacctagtgaagcc
aagtacattgttcgattcttagaaggaaagctcagacttggactggctgaaaagaccgtg
cttgttgcccttgcccaagctgtcgtcgcacacgaggccgctatggagggccacaagact
ccctctgccgagaaattggccgaaggtgaggccattctgaagactgtttacagcgaactg
ccggcgtatgaagtgattataccagccatcctcgagcatggcctctccaacttgccaaag
gtttgcaagctgcagccgggtattcccctcaaacccatgcttgccaaacccaccaagtcc
atcactgaagtgcttgaccggtttgaaggaaaggagttcacctgcgagtacaagtatgac
ggggaacgagcacaaatccactacgtcgctcctgactcgatccatcaatatccgggtgcg
acagccaccttgaagaaagatgccaagggtctcagtgcgatcttttcgcgtaattctgaa
gacctatcgaagaaataccctgacgttctagccaagcttgatggctggatcaaagagggc
gttcaaagctttgtactagactgcgagactgttgcttgggatacggagaacaagaaggtt
ctgccattccaacaactcatgactcgcaagaggaaggatgtcaaagcggaagatgtcaag
gtcaaggtttgcatattcgcctttgaccttctattcctgaatggcgagcctacagttaag
aagtccctacgagaacgccgtgagctgttacatgaatcctttcaggtgactgaaggagaa
ttccagttcgctcagtacggcaacaccaacgtactggatgaaatccagactttacttgat
gacagtgtgaaggcatcgtgtgaaggtctgatggtcaaaatgttggacacggaggaaagt
ggctacgagcctagtaaacgaagtcggaattggctcaaggtcaagaaggactacctcagt
ggggttggtgactctctcgatcttgttgtactaggtgcctatcatggccgaggcaagcgc
acatcagtctacggtgcgttccttttggctgcgtacaactcgagtacacaaacatatgag
acgatctgcaacatcggcacaggattctcggaagcggtcctggaagagttctacaatgca
ctctcccctttgacgattgatcggcccaagcccttctactcccattcaaacgtacccaag
gaccagcccgatgtatggttcgaaccgcggttagtgtgggaggtcaagactgcggatctg
acgctcagtcctcgatacaaggcagcggcagatgaatttatgggaacgactgggggagga
aagggcgtatctcttcgctttccccgattcatcaagtcccgagacgataagaagcccgag
caggcaacgaccacgcgggccgtggcggagatgtaccgcaagcaagaagcggtccagaag
gagaatgctggcaagggaggagtggatgatgatttcgagtactga

DBGET integrated database retrieval system