KEGG   Aspergillus niger: ANI_1_826184Help
Entry
ANI_1_826184      CDS       T01030                                 

Gene name
An04g04750
Definition
(RefSeq) 2-oxoglutarate dehydrogenase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ang  Aspergillus niger
Pathway
ang00020  Citrate cycle (TCA cycle)
ang00310  Lysine degradation
ang00380  Tryptophan metabolism
ang01100  Metabolic pathways
ang01110  Biosynthesis of secondary metabolites
ang01130  Biosynthesis of antibiotics
ang01200  Carbon metabolism
Module
ang_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ang_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ang00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ANI_1_826184 (An04g04750)
  09105 Amino acid metabolism
   00310 Lysine degradation
    ANI_1_826184 (An04g04750)
   00380 Tryptophan metabolism
    ANI_1_826184 (An04g04750)
Enzymes [BR:ang01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     ANI_1_826184 (An04g04750)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 4990882
NCBI-ProteinID: XP_001401841
UniProt: A2QIU5
LinkDB All DBs
AA seq 1055 aa AA seqDB search
MFRSTAVKATSGLRSPACSSCRRSLSLASTARSAANRSSKLGLTTRRPLALVDRLSNKRH
YAAPAEGVDANDSFLSGNTANYVDEMYVAWKRDPSSVHISWQTYFKNMEEGNMPVSQAFQ
PPPTLVPTPTGGVPQEMPGAGLSFAAGTDVTNHLKVQLLVRAYQARGHHKAKIDPLGIRG
EAEAFGYNKPKELELDHYGFTERDLDQEFNLGPGILPRFATEGRKKMTLREIISTCEKIY
CGSYGVEYIHIPDRKPCDWIRDRFEVPEPYKYSVDDKRRILDRLIWSHSFESFLATKFPN
DKRFGLEGCETLVPGMKALIDRSVDYGIKDIVIGMPHRGRLNVLSNVVRKPNESIFSEFA
GSAEPSDEGSGDVKYHLGMNFERPTPSGKRVQLSLVANPSHLEAEDPVVLGKTRSIQHYN
KDEQNFDSAMGVLLHGDAAFAAQGIVYETMGFHSLPAYSTGGTIHIVVNNQIGFTTDPRF
ARSTPYCSDIAKSIDAPVFHVNADDVEAVNYVCQVAADWRAEFKRDVVIDIVCYRKQGHN
ETDQPSFTQPLMYKRIAQQKSQLDKYVNKLIEEGTFTKEDIDEHKKWVWGMLNDSFDRSK
DYQPTSKEWLTSAWNGFKTPKELATEVLPHLPTGVEGPLLKDVADKISGGGSPEGFTLHK
NLKRILANRKKAVDEGQGIDWATAEALAFGSLVSEGYHVRVSGQDVERGTFSQRHAVLHD
QENEGTYTPLQNISENQGSFVISNSSLSEFGALGFEYGYSLTSPNALVMWEAQFGDFANN
AQCIIDQFIAAGESKWLQRSGLVVSLPHGYDGQGPEHSSGRMERWLQLCNEEPRVFPEGD
KLDRQHQDCNMQIVCMTSPANLFHVLRRQIHRQFRKPLVIFFSKSLLRHPLARSDIESFT
GDSHFQWIIPDPAHGKEIDEPEKIERVILCSGQVYAALTKHREAHGIRNTAITRVEQLHP
FPWAQLKENLDSYPNARNIVWAQEEPLNAGAWSYTQPRIETLLNETEHHNRRHVLYAGRA
PSASVATGLKSVHLKEEQEFLQDAFTVHQERLKGE
NT seq 3168 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgttctactgccgttaaggccaccagcggcctgcgcagtccggcctgctcttct
tgcaggagatcgctctctcttgcttctactgccagatctgctgccaaccgcagctcaaaa
ctcggcctgaccacgagacggcctctcgctctcgtcgaccgcttgtccaacaagaggcac
tatgctgcgcccgccgagggtgtggatgccaatgactctttcctctccggaaacaccgcc
aactacgtcgatgagatgtacgtcgcatggaagagagatccctccagcgtgcacatctca
tggcaaacgtatttcaagaacatggaggagggcaacatgcccgtctcccaggctttccag
cctcctccgactctcgtccctacccctaccggtggtgttcctcaggagatgcccggcgca
ggcctgtctttcgcggccggtaccgatgtcacgaatcacctgaaggttcagctcctggtc
cgcgcttaccaggctcgtggtcaccacaaggccaagatcgatcctcttggtatccgcggt
gaggccgaggccttcggttacaacaagcccaaggagctcgagctggaccactacggattc
actgagcgcgatctggaccaggagttcaaccttggacccggtatcttgccccgcttcgcc
actgagggacgcaagaagatgaccctgcgcgagatcatttccacctgcgagaagatctac
tgcggctcctacggtgtggagtacatccacatccccgaccgtaagccgtgcgactggatt
cgcgaccgcttcgaggttcccgagccctacaagtactctgtcgatgacaagcgccgcatc
ctcgaccgcctgatctggtcccacagcttcgagtccttccttgcgaccaagttccccaac
gacaagcgtttcggtctggagggttgtgagacccttgtgcctggtatgaaggccctcatc
gaccgcagtgtcgactacggtatcaaggacatcgtcattggtatgcctcaccgtggtcgt
ctgaacgtcctttccaacgtcgtccgtaagcccaacgagtccatcttcagtgagttcgct
ggttccgccgagccctctgacgagggatccggtgatgtcaagtaccacttgggtatgaac
tttgagcgccctaccccctcgggtaagcgtgtccagctttctctggtcgccaacccctct
cacttggaggccgaggacccggtcgttctcggaaagacccgctctatccagcactacaac
aaggatgagcagaacttcgactcggccatgggtgtgctgttgcacggtgatgccgctttc
gccgcccagggtatcgtctacgagaccatgggattccactccctccccgcctactccacc
ggtggtaccatccacatcgttgtgaacaaccagatcggtttcaccactgacccccgcttc
gcccgctccaccccttactgctcggacattgccaagtccattgacgctcctgtcttccac
gtgaacgcggatgatgttgaggcggtcaactacgtctgccaggttgctgccgactggcgt
gccgagttcaagcgtgacgttgtcatcgacatcgtctgctaccgtaagcagggtcacaac
gagaccgaccagccctctttcactcagcctctgatgtacaagcgcattgctcagcagaag
agccagcttgacaagtacgtcaacaagctgatcgaggagggtaccttcaccaaggaggac
atcgatgagcacaagaagtgggtctggggcatgctgaacgacagcttcgaccgcagcaag
gactaccagcccaccagcaaggagtggctgacctccgcctggaacggtttcaagaccccc
aaggagcttgccaccgaggttctgcctcacctccccactggtgttgagggtcctctgctg
aaggacgttgctgataagatcagcggtggtggtagcccggagggcttcaccctccacaag
aacctcaagcgtatcttggctaaccgcaagaaggccgtcgatgagggccagggtattgac
tgggctactgctgaggctcttgctttcggctcccttgtgtccgagggttaccacgtccgt
gtctccggtcaggatgtcgagcgtggtactttctcccagcgccacgccgtcctgcacgac
caggagaacgagggcacctacactcctctgcagaacatctctgagaaccagggaagcttc
gttatctccaactcctccctcagtgaattcggagctcttggtttcgaatacggttactct
ttgacctcccccaatgccctcgtcatgtgggaggctcagttcggtgactttgccaacaac
gctcagtgtatcattgatcagttcattgctgctggagagtccaagtggctgcagcgctcc
ggtctggttgtttctcttccccacggttacgatggccagggtcctgagcactcttccggt
agaatggagcgttggttgcagctctgcaatgaggagccccgtgtcttccccgagggtgac
aagctcgaccgccagcaccaggactgcaacatgcagatcgtctgcatgaccagccctgcc
aacctgttccacgttctgcgtcgccagatccaccgccagttccgcaagccccttgtgatc
ttcttctccaagtccctgctccgtcaccctcttgctcgctctgacatcgagagcttcacc
ggcgactcccacttccagtggatcatccccgaccccgcccacggcaaggagatcgatgag
cccgagaagattgagcgtgtcatcctgtgctctggccaggtttacgctgctcttaccaag
caccgtgaagcccacggcatccgcaacaccgccatcacccgtgttgagcagctgcacccc
ttcccttgggctcagctgaaggagaacctggacagctaccccaacgcccgcaacatcgtc
tgggcccaggaggagcctctgaacgccggtgcctggagctacacccagccccgtatcgag
actctgctgaacgagaccgagcaccacaaccgccgtcacgttctctacgccggtcgcgct
cccagcgcttccgtcgccactggtctcaagtctgtccatctcaaggaggagcaggagttc
cttcaggatgctttcactgtccaccaggagcgcctcaagggcgagtaa

DBGET integrated database retrieval system