KEGG   Aspergillus niger: ANI_1_844134Help
Entry
ANI_1_844134      CDS       T01030                                 

Gene name
An15g06250
Definition
(RefSeq) alcohol dehydrogenase
Organism
ang  Aspergillus niger
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc Pyr_redox_3 FAD_binding_3 DAO Shikimate_DH 2-Hacid_dh_C TrkA_N PALP Pyr_redox
Motif
Other DBs
NCBI-GeneID: 4988226
NCBI-ProteinID: XP_001397153
UniProt: A2R610
LinkDB All DBs
AA seq 356 aa AA seqDB search
MRAVRYHGRGDIRVEEIQEPGSCGVGEVKIRPAFVGICGSDIHEYLHGPSTIPSTTHPIT
GEKIPVTLGHEFSGTIIEVGEGVTRLQVGDNVAIKPNLFDGGCAACLGGWVNCCDNLGFV
GFSGSAGGLSDYVVVKEDRAVRLPEGFDLDLGALVEPLTVAWHAVNRSSIQNDHARTALV
VGAGPIGLAVLLVLKARGIESVVVVEVSSQRRELASSLGATRVLDPRTADVVGTVRAMTG
NAGADIAFECSAVQAGLDTALKGIRARGTMTILSLWSEKPAIDAFDVVLGEKHVVGSVIY
EDGEFEAVIEAMWSGKLNPRALITSKIRMEDIVEKGFKTLIHGRDNQIKILVDISA
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagtccgataccacggccgaggcgatatccgcgtcgaggagatccaggaaccc
gggtcgtgcggggtgggtgaggtgaagattcggcctgctttcgtgggtatatgcggtagt
gacatccacgaatacctccacggcccgtccaccatcccgagcacaacgcaccccataacg
ggggaaaagatccccgtgacactaggccacgagttcagcggcacgattatagaagtaggg
gagggtgtgactcgtctccaggttggtgataatgtggctattaagccgaatctgttcgat
ggagggtgtgcggcttgtctggggggttgggtgaattgttgtgataatttggggtttgtg
gggtttagtggtagtgctggtggattatcagattatgttgttgtcaaggaggatagggct
gtaaggttgccggaggggtttgatttggatcttggagcactcgtggagccgttgactgtg
gcatggcatgcagtcaatcggtcttctattcaaaatgatcatgcgcgtacggcactggtg
gtgggtgccgggcctattgggcttgctgtacttctggttcttaaggcccgcggcattgag
tccgttgtcgtcgtggaggtctcgtcgcagcggagggaacttgctagctctttgggcgct
acgcgggttcttgacccccggacggccgatgttgtgggcacggtgcgtgcgatgacgggc
aatgccggagctgatatagcatttgaatgctctgcagtgcaagcaggtttagacaccgct
ttgaaggggattcgagcacggggcacaatgacgattttatctctctggagtgagaagccg
gcaatcgatgcatttgacgtggtactaggcgaaaagcacgtggtagggtcggtgatatat
gaagacggagaatttgaggccgtcatcgaagctatgtggtcaggcaaactcaaccctcgg
gccttaatcaccagtaaaatccgcatggaggacatcgtagaaaaaggcttcaaaacgtta
atccacggccgagacaaccaaatcaagatcttggtggacatttctgcatga

DBGET integrated database retrieval system