KEGG   Aspergillus niger: ANI_1_944024Help
Entry
ANI_1_944024      CDS       T01030                                 

Gene name
An02g06860
Definition
(RefSeq) group II pyridoxal-5-phosphate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ang  Aspergillus niger
Pathway
ang00250  Alanine, aspartate and glutamate metabolism
ang00410  beta-Alanine metabolism
ang00430  Taurine and hypotaurine metabolism
ang00650  Butanoate metabolism
ang01100  Metabolic pathways
ang01110  Biosynthesis of secondary metabolites
Module
ang_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ang00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ANI_1_944024 (An02g06860)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ANI_1_944024 (An02g06860)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ANI_1_944024 (An02g06860)
   00430 Taurine and hypotaurine metabolism
    ANI_1_944024 (An02g06860)
Enzymes [BR:ang01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     ANI_1_944024 (An02g06860)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 4979176
NCBI-ProteinID: XP_001399821
UniProt: A5AA79
LinkDB All DBs
AA seq 561 aa AA seqDB search
MASAPPASRADEVQNLLRAVEDLLIPFIRSADEDPLPQQSLHNGINGDSQPRGTSLVEHK
KPEELQKLLQLDLPDQGTGQDGLIDVLRKVLRYSVNTWHQGFLDKLYASTNAPGVASELI
LAALNTNVHVYQVSPALTVIEKHTGKQLASLFGLNGPRAGGISVQGGSASNTTSIVIARN
NLYPSTKKDGNGNYRFVLFTSAHGHYSIEKAAQMLGLGSSSVWAVPIDKQGRMIPSELEA
LVQKALAEDRTPFYVNATAGTTVMGSFDPFHEIADICKKYNLWFHVDGSWGGSFIFSSEQ
RAKLSGAEKADSIAINPHKMLGVPVTCSFLLAADIRRFHLANTLPAGYLFHNEDTAAAPD
TLNGETELVVDSPEVWDLADLTLQCGRRADSLKLFLSWTYYGTAGYERQIDSACAVAAHL
ATLVEQNPNFVLVSENPPPCLQVCFHYAPNRAFVHPRGLVSNETERGKANSKVTEQITHT
IVNKGFMVDFAPPSGDEDAVGNGKFFRCVVNVQTTRETVEALIRAIEEVGPGIVERLKRE
SAGEVSTRRLGERGHGPVVHH
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggcttctgccccgccggccagtcgcgccgatgaagtacaaaatcttctgagagccgtc
gaagacctgctgattccgttcatccgaagcgccgacgaggaccctttgccccagcaatca
ctgcacaacggcatcaatggcgactcccagcctcgaggcacgtccctcgtagaacacaag
aagccagaagagctgcagaaactcctccaattagacctccccgatcaaggaaccggacaa
gacggtctgatcgacgtcctgcgcaaggttctgcgctactcggtcaacacatggcaccag
ggattcctcgacaagctttatgcatcaaccaacgcccccggcgtagcgtcggagcttatc
ctcgcggcgctcaacaccaacgtccacgtctaccaggtctccccggccctcaccgtcatt
gagaaacacaccggaaagcaacttgcctctctcttcggcctcaatgggccccgcgccggc
ggcatctccgtccaaggtggctctgcctccaacaccacctccatcgtgatcgcgcgcaac
aacctctaccccagtaccaagaaagatggcaatggcaactaccgcttcgtgctcttcacc
agcgcccacggccactacagcatcgaaaaggccgcccagatgctcggcctcggcagctcc
tccgtatgggccgtccccatcgacaaacaaggccgcatgatcccctccgagctcgaagcc
ctcgtccaaaaggccctcgctgaggaccgcacccccttctacgtcaacgccactgccggc
acaaccgttatgggctccttcgatcccttccacgaaattgccgacatctgcaagaaatac
aacctgtggttccacgtcgacggctcctggggcggttccttcatcttctcctccgaacaa
cgcgccaaactctccggcgccgaaaaagcagacagcatcgccatcaacccccacaaaatg
ctcggcgtccccgtcacctgctcgttcctcctcgccgctgacatccgtcgcttccacctc
gccaacaccctccccgccggctacctcttccacaacgaagacaccgccgccgcaccagac
accctgaacggcgagaccgaactcgtcgtcgactcccccgaggtctgggacctcgcggat
ctcaccctccaatgcggccgtcgcgcagactctctcaagctcttcctcagctggacctac
tacggtaccgccgggtacgagcgccagatcgattccgcctgcgccgtggcagcgcacctc
gctacactggtcgagcagaacccgaacttcgtcctcgtgagcgagaacccgccgccatgc
ttgcaggtgtgcttccactatgcgccgaaccgtgcgttcgtgcatccgcgcgggctggtc
tcgaatgagacggagcgcggcaaggcgaatagtaaggtcacggagcagattactcatact
attgtgaacaaggggttcatggtggattttgccccgccgagtggggatgaggatgccgtg
ggcaatgggaagttcttccgttgtgtggttaatgttcagacgacgagggagacagttgag
gcgctgattcgggcgattgaagaggttggacccgggattgtggagaggttgaagagggag
agtgctggggaggtgtcgacgaggaggttgggggagagggggcatgggcctgttgtgcat
cattga

DBGET integrated database retrieval system