KEGG   Altererythrobacter namhicola: A6F65_00080Help
Entry
A6F65_00080       CDS       T04447                                 

Definition
(GenBank) Alpha-D-glucose-1-phosphatase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
anh  Altererythrobacter namhicola
Pathway
anh00361  Chlorocyclohexane and chlorobenzene degradation
anh00625  Chloroalkane and chloroalkene degradation
anh01100  Metabolic pathways
anh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:anh00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    A6F65_00080
   00361 Chlorocyclohexane and chlorobenzene degradation
    A6F65_00080
Enzymes [BR:anh01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     A6F65_00080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: ANU06408
UniProt: A0A1C7D4M5
LinkDB All DBs
Position
complement(76162..76764)
Genome map
AA seq 200 aa AA seqDB search
MTKAVVFDVGRVLIQWDLRCLFAKLIADEAELDWFLTHVVTEQWHFQTDAGRPVAEIVAE
RKAEFPQHAALIQAYRDRFLETVPGPVPGTAALVDRLAAIGVPLFALTNFGSEFWPQFRP
TCPPLRHMRDVVVSGDERLAKPDPRIYALAEERFGRVGDALFFTDDNPDNIAAAKARGWD
AVLFEDAAQLERELQARGLL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaggccgtcgtcttcgatgtcgggcgggtgctgatccagtgggatctgcgctgc
ctgtttgcaaagttgatcgccgacgaggcggagctggactggttcctgacccacgtcgtg
accgaacaatggcacttccagaccgatgcggggcgcccggtggccgagatcgtcgcagag
cgcaaggccgagttcccgcagcatgccgcgctgatccaggcgtaccgcgaccggttcctg
gaaaccgtgcccggccccgtcccgggaacggcggcgctggtggaccggctggcggcaatc
ggcgtgccgctgttcgcgctcaccaatttcgggtcggagttctggccgcagttccgcccc
acctgcccgccgctgcggcacatgcgcgatgtggtggtgagcggcgacgaaaggctcgcg
aagcccgatccgcggatttacgcgctggcagaggagcggttcggccgcgtgggcgacgcg
ctgttcttcaccgatgacaaccccgacaatatcgccgctgcaaaggcgcgcggatgggac
gcggtgctgttcgaagatgccgcgcaattggagcgcgaattgcaggctcgcggcctactc
tga

DBGET integrated database retrieval system