KEGG   Altererythrobacter namhicola: A6F65_01832Help
Entry
A6F65_01832       CDS       T04447                                 

Gene name
sdhB
Definition
(GenBank) Succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
anh  Altererythrobacter namhicola
Pathway
anh00020  Citrate cycle (TCA cycle)
anh00190  Oxidative phosphorylation
anh00650  Butanoate metabolism
anh01100  Metabolic pathways
anh01110  Biosynthesis of secondary metabolites
anh01120  Microbial metabolism in diverse environments
anh01130  Biosynthesis of antibiotics
anh01200  Carbon metabolism
Module
anh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
anh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
anh_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:anh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A6F65_01832 (sdhB)
   00650 Butanoate metabolism
    A6F65_01832 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    A6F65_01832 (sdhB)
Enzymes [BR:anh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     A6F65_01832 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     A6F65_01832 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_7
Motif
Other DBs
NCBI-ProteinID: ANU08127
UniProt: A0A1C7D9M2
LinkDB All DBs
Position
1840122..1840901
Genome map
AA seq 259 aa AA seqDB search
MATFTLPKNSRIKQGDSYRTEGATRTKSFKIYRYDPESGENPRYDTFEIDLDDCGPMVLD
ALFKIKNDMDPTLTFRRSCREGICGSCSMNLNGKNGLACTTAIEDLKGEIRITPLPHMEV
IKDLVPDFTHFYAQYASIRPWLQTVTPTPSGKERLQSPEQREKLDGLYECILCACCSTSC
PSYWWNSDKFLGPAILLQAYRWLADSRDEMTGERLDDLEDPFRLYRCHTIMNCANACPKG
LSPAKAIAETKKMMAERHV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggccaccttcaccctccccaagaacagccgcatcaagcagggcgatagctatcgcacg
gaaggggccacgcggacgaaaagcttcaagatctatcgctacgatccggaaagcggcgaa
aacccgcgctatgacaccttcgagatcgacctcgacgattgcggcccgatggtgctggac
gccctgttcaagatcaagaacgacatggatccgacgctgaccttccgccgctcctgccgc
gaaggcatctgcgggtcatgctccatgaacctcaacggcaagaacggcctggcctgcacc
actgcgatcgaggacctgaagggcgaaatccgcatcacgccgctgccgcacatggaagtg
atcaaggacctcgtccccgatttcacgcacttctacgcgcagtatgcctccatccgcccc
tggctgcagaccgtcacccccacccccagcggcaaggaacgcctgcaatcgccggaacag
cgcgagaagctggatgggctgtacgagtgcatcctgtgcgcctgctgctccaccagctgc
cccagctattggtggaacagcgacaagttcctcggccctgctatcctgctgcaggcctat
cgctggctggcggacagccgcgacgagatgacgggtgagcggctggacgatctggaagat
ccgttccgcctgtatcgctgccacacgatcatgaactgcgcgaatgcctgccccaagggc
ctcagcccggccaaggccatcgccgaaaccaagaagatgatggcggagcggcacgtctga

DBGET integrated database retrieval system