KEGG   Aspergillus nidulans: AN2332.2Help
Entry
AN2332.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
ani  Aspergillus nidulans
Pathway
ani00020  Citrate cycle (TCA cycle)
ani00190  Oxidative phosphorylation
ani01100  Metabolic pathways
ani01110  Biosynthesis of secondary metabolites
ani01130  Biosynthesis of antibiotics
ani01200  Carbon metabolism
Module
ani_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ani00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AN2332.2
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AN2332.2
Enzymes [BR:ani01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AN2332.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_7
Motif
Other DBs
NCBI-GeneID: 2875591
NCBI-ProteinID: XP_659936
UniProt: Q5BAU8 A0A1U8QWN1
LinkDB All DBs
Position
VII
AA seq 273 aa AA seqDB search
MASLRTTSRLVASSRSLFRPATFARSYATVESAQEPAPQMKKFQVYRWNPDKPSEKPKMQ
TYELDLKKTGPMMLDALIRIKNEIDPTLTFRRSCREGICGSCAMNIDGVNTLACLCRIPT
DTTKESRIYPLPHTYVVKDLVPDLTQIYKQYKSIKPYLQRDTKTEDGLENRQSPEDRKKL
DGLYECILCFCCSTSCPSYWWNSEEYLGPAILLQSYRWLADSRDQKTAERKHAIDNSMSV
YRCHTILNCTRTCPKGLNPARAISEIKKMLAAH
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggcctctcttcgcacaacttcgcgccttgtcgcctcctcaaggtcgcttttccgtcct
gcgacctttgctcgttcgtatgcgacggtcgagtctgctcaggagcccgcgccccagatg
aagaagttccaggtctaccgctggaaccccgataagccctccgagaagcccaagatgcag
acctacgaattggacctgaagaagaccggccctatgatgctggacgcgctcatccgcatc
aagaacgaaatcgaccccaccctgaccttccgacgaagttgccgtgagggtatctgcggt
agctgcgcgatgaacatcgacggagtcaacacccttgcttgcttgtgccgtattcctacc
gacaccaccaaggaatcccgcatctacccgttgccacacacctacgtcgtcaaggatctc
gttcccgatttgacccagatctacaagcagtacaagtcgatcaagccttacctgcagcgc
gataccaagaccgaagatggccttgagaaccgccagagccccgaggaccgcaagaagctg
gacggtctgtacgagtgcattctctgcttctgctgctcaacctcctgcccgtcgtactgg
tggaacagcgaggagtacctcggccctgccatcctcctccagtcctaccgatggttggcc
gattcgcgtgaccagaagaccgccgagcgcaagcacgccattgacaacagcatgagcgtg
taccgttgccacactatccttaactgcacacggacctgccccaagggtctgaaccctgcc
cgggctatttccgagatcaagaagatgttggctgctcactag

DBGET integrated database retrieval system