KEGG   Aspergillus nidulans: AN2916.2Help
Entry
AN2916.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ani  Aspergillus nidulans
Pathway
ani00020  Citrate cycle (TCA cycle)
ani00190  Oxidative phosphorylation
ani01100  Metabolic pathways
ani01110  Biosynthesis of secondary metabolites
ani01130  Biosynthesis of antibiotics
ani01200  Carbon metabolism
Module
ani_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ani00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AN2916.2
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AN2916.2
Enzymes [BR:ani01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AN2916.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like PAPS_reduct
Motif
Other DBs
NCBI-GeneID: 2874150
NCBI-ProteinID: XP_660520
UniProt: Q5B964
LinkDB All DBs
Position
VI
AA seq 633 aa AA seqDB search
MPVATLDQRRLFSSSRPAARIFGTNPLRAKPAEGYISEKYPVIDHEYDAVVVGAGGAGLR
AAFGLAEAGFNTACVSKLFPTRSHTVAAQGGINAALGNMHPDDWRWHMYDTVKGSDWLGD
QDAIHYMTREAPASVRELEGYGCPFSRTEEGLIYQRAFGGQSKEFGKGGQAYRCCAVADR
TGHALLHTLYGQSLRHNTNYFIEYFAMDLLMENGECRGIIAYNQEDGTLHRFKAHHTVLA
TGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTGIYGAGCLITEGARGEG
GYLLNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPEKDHIYLQLSHLPASL
LHERLPGISETASIFAGVDVTKQPIPVLPTVHYNMGGIPTKFTGEVLTQDENGNDKVVPG
LYACGEAACVSVHGANRLGANSLLDLVVFGRAVSHRVKEIASPGKPHAELASDAGAESIK
DLDTVRTAEGPKSTFEIRNAMQKTMQTDVSVFRTQESLDEGVEKITKVDQLFDQVGTKDR
SMIWNSDLVETLELRNLLTCATQTAVAAANRKESRGAHAREDYPDRDDENWMKHTLTWQK
KPHGKVEIGYRSVVHNTLDENECKPVPPFKRVY
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
ttgccagttgcaaccctagatcagagacgtttgttctcctcatcccgccctgcagcccgc
attttcggcacgaaccctttgcgcgctaagcctgctgaaggctatatctcagagaaatat
ccggtcattgaccacgagtacgatgcggtcgtcgtcggtgctggaggcgctggtctgcgt
gccgcgttcggtttggcggaagctggattcaacactgcctgtgtctcgaagctcttccct
actcgatctcacaccgttgctgctcagggtggtatcaacgctgctcttggaaacatgcac
cccgatgactggagatggcacatgtacgataccgtgaagggttccgattggcttggtgac
caggatgctattcactacatgacgagggaggcccccgctagtgtccgtgagctcgagggc
tacggatgccccttctcgcgtaccgaggaaggcctcatctaccagcgtgctttcggtggt
cagtccaaggagttcggtaagggcggacaggcgtaccgttgctgcgccgtcgccgaccgt
accggccacgctcttctgcacaccctctacggacagtctctgcgccacaacaccaactac
ttcattgagtacttcgccatggatctgctgatggagaacggcgagtgccgcggtatcatc
gcttacaaccaggaggatggaactctccaccgtttcaaggctcaccacacagttcttgct
accggtggatacggtcgtgcctacttcagttgtacctctgctcacacctgtaccggtgac
ggtatggccatggttgcccgtgccggtctccctaaccaggatctggagttcgtccagttc
caccccactggtatctacggtgctggatgcttgatcacagagggtgcccgtggtgagggt
ggttacctgctcaactccgagggtgagcgtttcatggagcgttacgcccctaccgctaag
gatctggcctcccgtgacgtcgtctcccgttccatgaccatggagatccgtgagggccgt
ggtgtcggtcccgaaaaggaccacatctaccttcagctcagccaccttcccgcctctctc
ctgcacgagcgtctccccggtatctctgagaccgcttccatctttgctggtgttgatgtg
accaagcagcccatccccgtcctgcccaccgtccactacaacatgggtggtatccccacc
aagttcaccggtgaggtcctgacccaggatgagaacggcaacgacaaggttgttcccggt
ttgtacgcttgcggtgaagccgcctgtgtctctgtccacggtgccaaccgtctcggtgcc
aactccctcctggatctggtcgtcttcggtcgtgctgtttctcaccgtgtcaaggagatc
gcctcccccggcaagccccacgccgagctggcctccgacgctggtgccgaatccatcaag
gaccttgacactgtccgcactgctgagggccctaagtccaccttcgagatccgcaacgcc
atgcagaagaccatgcagaccgacgtctctgtcttccgtacccaggagagcttggatgag
ggtgttgagaagatcaccaaggtcgaccagttgttcgaccaggtcggtaccaaggaccgc
agcatgatctggaactccgatcttgttgagactcttgagcttcgtaaccttttgacttgc
gccactcaaactgccgttgccgccgccaaccgcaaggagtcccgtggtgcccacgcccgt
gaggactaccccgaccgtgacgacgagaactggatgaaacacactctcacatggcagaag
aagcctcacggcaaggtcgagatcggctaccgcagcgtcgtgcacaacacccttgacgag
aacgagtgcaagcctgttcctcccttcaagcgtgtctactaa

DBGET integrated database retrieval system