KEGG   Aspergillus nidulans: AN3255.2Help
Entry
AN3255.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ani  Aspergillus nidulans
Pathway
ani00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AN3255.2
Enzymes [BR:ani01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AN3255.2
Transporters [BR:ani02000]
 Other Transporters
  Pores ion channels [TC:1]
   AN3255.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C GST_N GST_N_3 GST_N_2 GST_C_3 GST_C_2
Motif
Other DBs
NCBI-GeneID: 2874200
NCBI-ProteinID: XP_660859
UniProt: Q5B875 A0A1U8QJ96
LinkDB All DBs
Position
VI
AA seq 327 aa AA seqDB search
MTKPLTVWLTPPGPNPWKANNPQVITVLNELGVPYNIHSFKFDDVKKPPFININPNGRVP
AIVDPNTDLTLWESGAILQYLEDVYDTEKKLTYTSLKEKHLLNQWLHFQMSGQGPYFGQA
GWFNVLHAEKLPSAIERYENEVHRILGVLNTALEGRNWLVGDKCTFADLAFLPWNARVNM
VLLTPEGEDPLAPYPNVQAWQRRMEMRESWREAMRTRDRLMDEQGLMPNGMPKGVSNMKE
YEELMSRQAKEREGKYRKETTNRPCNMMALKSVFHLLSTPQIQVRFLKALSTSARDSVVE
GGMEETKEIPPKTYLSTRCLLRHCLFD
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaccactcaccgtctggctcacgcccccaggtccgaacccatggaaggctaac
aatcctcaggtcatcacggtcctgaatgaactaggagtcccatacaatatccactcgttc
aagtttgacgacgtgaagaaaccgccgttcatcaacatcaacccgaatggacgagttccc
gcgattgttgacccaaacactgatttgaccctgtgggaatccggcgcaatcctccagtat
ctcgaggatgtgtacgacacggagaaaaagctaacctacacctccttgaaggaaaaacac
cttctgaatcagtggctccatttccagatgagcgggcagggaccttatttcggacaggcc
ggatggttcaacgtcttgcatgctgaaaaacttccttccgcaattgagcggtacgagaat
gaagttcatcgcatcctcggcgtgctcaacacagcactagaaggccgcaactggctcgtc
ggcgataaatgcacgttcgctgatttggccttcctcccctggaatgcccgcgtcaacatg
gtgcttctgacgcctgagggcgaagaccctcttgcgccgtacccgaatgtccaggcctgg
cagcgccgcatggaaatgcgcgagtcgtggcgtgaggcgatgcgtacgagagatcggctg
atggacgaacaggggctgatgccgaacggaatgccgaagggggtatcaaacatgaaggaa
tatgaggaattgatgtcaaggcaggcgaaagagagggaggggaagtacagaaaggagact
acgaaccgcccctgcaatatgatggcactaaaatctgtcttccatcttctatctacgccc
cagattcaagttcgctttcttaaagctctcagtactagtgctcgagattcggtagtagaa
ggtggcatggaggagaccaaagaaataccaccaaagacttatctaagcactagatgtctc
cttcgacactgcctttttgactga

DBGET integrated database retrieval system