KEGG   Aspergillus nidulans: AN3402.2Help
Entry
AN3402.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
ani  Aspergillus nidulans
Pathway
ani00500  Starch and sucrose metabolism
ani01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AN3402.2
Enzymes [BR:ani01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AN3402.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase CBM_20 DUF1966
Motif
Other DBs
NCBI-GeneID: 2874098
NCBI-ProteinID: XP_661006
UniProt: G5EAT0 A0A1U8QIQ3
LinkDB All DBs
Position
VI
AA seq 623 aa AA seqDB search
MRLLALTSALALLGKAVHGLDADGWRSQSIYFLLTDRFARTDGSTTAACDLAQRRYCGGS
WQGIINQLDYIQDMGFTAIWITPITEQIPDVTAVGTGFHGYWQKNIYGVDTNLGTADDIR
ALSEALHDRGMYLMLDVVANHMSYGGPGGSTDFSIFTPFDSASYFHSYCAINNYDNQWQV
ENCFLGDDTVSLTDLNTQSSEVRDIWYDWIEDIVANYSVDGLRIDTVKHVEKDFWPGYID
AAGVYSVGEIFHGDPAYTCPYQDYMDGVMNYPIYYPLLNAFKSSSGSMSDLYNMINTVAS
NCRDPTLLGNFIENHDNPRFPNYTPDMSRAKNVLAFLFLTDGIPIVYAGQEQHYSGSNDP
YNREPVWWSSYSTSSELYKFIATTNKIRKLAISKDSSYLTSRNTPFYSDSNYIAMRKGSG
GSQVLTLLNNIGTSIGSYTFDLYDHGYNSGANLVELYTCSSVQVGSNGAISIPMTSGLPR
VLVPAAWVSGSGLCGLTNPTSKTTTATTTSTTTCASATATAITVVFQERVQTAYGENVFL
AGSISQLGNWDTTEAVALSAAQYTATDPLWTVAIELPVGTSFEFKFLKKRQDGSIVWESN
PNRSAKVNEGCARTTQTISTSWR
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgcgactgctcgcgttgaccagcgcgctggccttactcggcaaagccgtgcatggattg
gatgcggatggatggcgcagccagtcgatctatttcctcctgacggaccgattcgctcgc
acggacggatcgacgaccgctgcctgtgatctggctcaacggagatactgcggcggcagc
tggcagggcatcatcaaccagcttgattatatccaagacatgggattcactgccatctgg
attacacctatcaccgagcagattcccgatgtcaccgctgttggaacgggcttccatggc
tactggcagaagaacatatacggtgtcgacaccaacctgggcacagccgacgatatcagg
gctctgtcggaggcgctccatgatcggggcatgtatctcatgctggatgttgttgcgaac
cacatgtcttatggcggccccggcggatcaactgacttcagcatatttaccccgttcgac
tcggcgtcctacttccattcgtactgcgcaatcaacaactatgacaatcagtggcaggtt
gagaactgcttcctgggggacgataccgtctccttgactgatctgaacacccagagctcc
gaggtacgcgacatctggtatgactggatcgaggacatcgttgccaattactctgtggat
gggctccgcattgataccgtcaagcacgttgagaaggatttctggccgggttatattgat
gccgctggggtctacagcgttggtgaaatcttccatggggacccggcgtatacctgccct
taccaggattatatggacggggtcatgaactaccccatatattacccccttctgaatgcg
ttcaagtcctcgagcgggagcatgtcggatctctataacatgatcaacacagtcgcctca
aattgtcgggatcctacactgcttggaaactttatcgagaaccatgacaatcctcgattc
cccaactatactccggatatgagtcgggccaagaacgtcctcgcgttcctcttcttgacc
gacggaatccctattgtttatgcgggccaggagcaacactattcaggcagcaatgatccc
tataaccgggagccggtttggtggtcctcctactcgaccagctcagagctatacaagttc
atcgcgaccactaacaagatccgaaaactggccatttccaaagattccagttatctcact
tcccggaatactcctttttacagcgatagcaactatatcgccatgcgcaagggctctggg
ggctctcaggtcctcactctcctcaacaatatcggcaccagtatcggttcctatacattc
gacctgtatgatcatggatacaacagcggcgccaacctagtggaactgtacacatgctcc
tctgtccaggtcggctccaacggcgcaatcagtatcccaatgacatctggcctcccccgc
gtccttgttccagcagcttgggtttctggcagcgggctgtgcggcttgacgaaccctaca
agtaagacgaccactgcaacgactacctcgaccacgacatgtgcctcggccacagcgaca
gcaatcactgttgtatttcaggaacgggtgcagaccgcatacggtgaaaacgtcttcttg
gctgggtcgatctctcagctcggcaactgggataccaccgaggcagttgctctgtccgcg
gcccagtataccgctacggaccccctgtggactgtggccattgagctgcctgtggggacc
tcgttcgaattcaagttcctcaagaaacggcaggatggatcgatcgtctgggagagtaat
ccgaatcggtctgctaaagtgaacgagggatgtgctaggaccacgcagacaataagcact
tcctggaggtag

DBGET integrated database retrieval system