KEGG   Aspergillus nidulans: AN4516.2Help
Entry
AN4516.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
ani  Aspergillus nidulans
Pathway
ani00730  Thiamine metabolism
ani00790  Folate biosynthesis
ani01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ani00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    AN4516.2
   00790 Folate biosynthesis
    AN4516.2
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ani04147]
    AN4516.2
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ani00537]
    AN4516.2
Enzymes [BR:ani01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     AN4516.2
Exosome [BR:ani04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AN4516.2
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ani00537]
 Enzymes
  AN4516.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase DUF498 Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 2872317
NCBI-ProteinID: XP_662120
UniProt: Q5B4L4
LinkDB All DBs
Position
III
AA seq 835 aa AA seqDB search
MHPPSLQLLRALRTSISPKGAKPAIPLCANLNRFQSPIAVAFASPHRSNSSSNGSTHIRP
ARMVSRAHPSKPRTHDRGPPSKEDTQTDFAALNVLGNIPTPTTAVDACLDTGFHLDNGVK
ITGGDGVMLVGGEAFTWRPWMSKKDGTKNNMINAKGQFEVDEQVWGILDLVWPRPGIRVE
VLDTRNAAAQFNLLATERGVSEIAAAMIPIGWKGSSPTPTPTRGDIDPTISSIRYVPIMP
REEPLLAPRQSSEQSSIRNAEEEDALLTGERTHRGGSRRGWGFWREVGLFSWALIATVAV
IILAIVYQRESSWIQSHKKETWGPGGKPTGKRNLIFMVSDGMGPTSLTMTRSFKQLTQGL
PADEVLVLDRHILGTSRTRSSSSLVTDSAAGATAFSCGFKSYNGAISVLPDHSPCGTVLE
AASLAGYKTGLVVTTRITDATPACFASHANLRQYEDQIAEQEIGEHPLGRVVDLIMGGGR
CHFLPNTTDGSCRGDDRDLVAVAKEKGFSYIDDRKGFDSLNGGTEAKLPLLGLFAEKDIP
YELDRRTQNDVYPSLEEMARTALKILSHATEDSDQGFFLMIEGSRIDHAGHGNDPAAQVN
EVLAYDKAFAAVLEFLNDDSTPGVLVATSDHETGGLAVARQLHDTYPEYLWLPGVLANVS
HSSEYAAQKLQDYRRQKTDKPSQEAYTRDLLKKSLGIEDASQQEIDALLDPNNPIIPSYV
FADMQLIPPKGVDVNIYASSSRDAWPLQGNHENTEIGAFLADYLDLDVSAVTKRLQNSEF
WTAAESISVSESFNWLGNPLGDDVRTDGLDTYHGDFKRKRGFSGDADECGCGGVH
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atgcatccaccttcgctccagctccttcgagcccttcgaacatccatctccccaaagggt
gccaaacctgccatccccctctgcgcaaacttgaaccgtttccaatcacctattgccgtg
gcatttgcttctcctcaccgcagcaatagcagctctaatggctctacgcacatccgccca
gcccgcatggtctcccgggctcacccatcgaaacctcgcacccacgaccgcggcccaccg
tcaaaagaggacacgcagactgatttcgccgcactgaacgtactcggaaacattccgacc
ccgacgactgctgttgacgcctgtctagatacgggcttccatctggacaatggcgtcaag
attacaggtggtgacggagttatgcttgtcggtggagaagcgtttacatggaggccttgg
atgagtaagaaggatgggaccaagaacaacatgatcaatgcaaagggacaatttgaagtg
gatgagcaggtttggggtatattggacttggtatggcctcgtccggggatccgggttgag
gtgctagatacaagaaacgctgctgcgcagttcaacctgctcgcgaccgagaggggagtt
tctgaaattgcggctgcgatgataccgatcggatggaaggggagttccccaactccaact
ccgactcgcggcgacatcgaccccaccatttcctctattcgctacgttcccataatgccg
cgagaagagcctcttctggctccacgccaatcatcagaacagtcatccattcgaaatgct
gaggaggaagacgccttgttgactggcgagcggactcaccgcggtggaagtcgtcgtgga
tggggcttctggagagaggtcggcctcttttcctgggctctaatagccaccgttgctgtt
attatccttgcaatcgtctatcagcgagagtcaagctggatacagagtcacaagaaagaa
acatggggtccaggaggaaaaccaaccggcaaacgcaaccttatcttcatggtctcggac
gggatgggcccaactagtcttaccatgactcgaagcttcaaacagcttacgcaagggctt
ccagctgacgaggtcctcgtgttggacaggcacattcttggtacttcacggacaaggtcc
agctcgagtctggtcaccgactcagcagccggagcgacggcattctcgtgcgggttcaaa
agttacaacggcgccatctctgtgcttcccgaccactcaccttgtggaacagtacttgag
gccgcatctttggctggttacaagactgggttggtggtgactacccgcatcaccgacgct
acaccagcttgcttcgcgtcgcacgcaaaccttcgacagtatgaagaccagatagcagag
caagaaattggtgaacacccactgggccgtgtggtagacctcataatgggtggtggacgg
tgccattttctgcccaatacaacggacggtagctgccgcggagatgatcgtgatctggtg
gcagtcgccaaggagaaggggttctcttacattgacgaccggaaaggttttgacagcctc
aatggtgggacggaagcaaagctaccgctgctgggactctttgctgagaaggacatccct
tacgaactcgatcgccgcactcagaatgatgtgtatccctctttggaggagatggctcgg
accgcgttgaagatccttagccatgctacagaggacagcgatcaaggatttttcctcatg
attgaggggtcccgcatcgaccacgcaggccatggtaacgacccagccgcgcaagtcaac
gaagtgctcgcctacgataaggcctttgctgcggtcctcgagttcctcaacgacgattcc
accccaggggtcctggttgcaacatccgaccacgaaactggaggactcgctgtagctcga
caactacatgacacttaccccgaatacctctggctccctggcgttctggccaacgtcagt
cactcctcggaatatgccgctcaaaagcttcaagactaccgccgccagaagaccgacaag
ccctctcaggaggcctacacgcgggacctcctcaagaaatctttaggcatcgaagacgcc
tcacagcaagaaatagacgccctacttgatcccaacaacccaatcatccctagctatgtc
ttcgccgacatgcaactaatccctccaaaaggtgtcgacgtaaatatctacgcttcctcg
tcaagagacgcctggccgctacaaggtaaccacgaaaataccgaaatcggcgccttccta
gccgactacctcgacctcgacgttagcgccgtcacaaaacgcctccagaactctgagttc
tggaccgccgctgaaagcataagcgtaagcgagagcttcaactggctgggcaacccgctc
ggcgacgacgtccgcaccgacggactcgatacgtatcatggggactttaagcggaagcgc
ggattcagcggtgacgctgatgagtgcgggtgtggtggtgttcattag

DBGET integrated database retrieval system