KEGG   Aspergillus nidulans: AN4883.2Help
Entry
AN4883.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ani  Aspergillus nidulans
Pathway
ani03030  DNA replication
ani03410  Base excision repair
ani03420  Nucleotide excision repair
ani03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ani00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AN4883.2
   03410 Base excision repair
    AN4883.2
   03420 Nucleotide excision repair
    AN4883.2
   03430 Mismatch repair
    AN4883.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ani03032]
    AN4883.2
   03400 DNA repair and recombination proteins [BR:ani03400]
    AN4883.2
Enzymes [BR:ani01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AN4883.2
    6.5.1.6  DNA ligase (ATP or NAD+)
     AN4883.2
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     AN4883.2
DNA replication proteins [BR:ani03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    AN4883.2
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     AN4883.2
DNA repair and recombination proteins [BR:ani03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     AN4883.2
   NER (nucleotide excision repair)
    Other NER factors
     AN4883.2
   MMR (mismatch excision repair)
    Other MMR factors
     AN4883.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C Herpes_UL32
Motif
Other DBs
NCBI-GeneID: 2872686
NCBI-ProteinID: XP_662487
UniProt: Q5B3J7 A0A1U8QTZ5
LinkDB All DBs
Position
III
AA seq 816 aa AA seqDB search
MSSPAKKRKRDTQPTRSIASFFQGQTAKQTEKSEQLASLADTEQHLSDEALARKLQAEWN
NEQDFASPATVPHSEPTAASPSPEKDREQKKAKVGVLSLQSSTGTEDTISLSVPFDQSPL
VFDSSRYAGELKAHWSAEGGNASYALLTRAFVLANSTTSRIKIVDTLVNFLRVLIEGDPS
SVLPAVWLATNSISPPYHELELGLGGSSISKAFKKIYGLNSQGLKSLYDRLGDAGDVAFE
AKKRQSFTLIKPKPLSIKGVYQSLIKIAMSKGSGSQELKQRIVEKLLQDTRGAEESRYIV
RTLVQNLRIGAVKTTMLIALARAFLVSKPDNATFTVHSQHELARLKKEELAEIYSSAEEL
VKASYARHPNYNDLVPCLLEIGVTEELLLRCGLQLHIPLMPMLGSITRDLSEMLTKLQGR
DFTCEFKYDGQRAQVHCDEAGKVSIFSRHLEEMTEKYPDLVSLVPQIRGEGVSSFILEGE
VVAVDQNGELQPFQILTNRAKKNVDIGEIKINVCLFAFDLMYLNGAPLLERSLRERRELL
RSLFMEIPNRFTWVKSLDATSADSEAVLDFFKSATENKCEGIMVKVLDNTLATNGSDSTN
SSITATPKAEAKETKKGGRRKALLSSYEPDKRLESWLKVKKDYSASSETLDLIPVAGWHG
NGRKAKWWSPILLAVRNPETGGLQAVTKCMSGFSDKFYQANKEKYEEGSPNVISRPSYVE
YNGEPDVWFEPQEVWEMAFADITLSPTYPAAIGLRFSDRSLQGISPMPVDDLQLCYRWQE
NVKGRILAERASAESIVATQLKRPYVALMNIIDYQT
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagccctgccaaaaagcgcaagagagacacccagcccacacgcagcatcgcgtca
ttcttccagggccaaacggccaagcagactgagaaatcggagcagttagcttcgctggca
gacacagaacagcatctatctgacgaagctcttgctcggaagcttcaggctgaatggaat
aacgagcaagatttcgcgtctcccgcgactgtacctcattccgaacctaccgccgcatcc
ccctcaccagagaaggatcgagaacagaagaaggccaaggttggagtgctctcattgcag
tcatcaacaggaaccgaggacacgatatctttatctgtccctttcgatcagagccctttg
gtattcgattcctctaggtacgctggagagttgaaagcgcactggtcggcggagggtggg
aatgcttcgtatgctcttcttactagagcattcgttcttgcaaattcaactaccagtcgt
atcaagattgtcgatacattggtcaactttctccgggttctcattgaaggggatccttcg
agcgtactccccgcagtatggctggcaacaaactccatttccccgccatatcacgaactc
gagctcgggctcggcgggtcttcgatatctaaagccttcaagaagatctacggcctgaat
agccaagggcttaaatcgttatatgataggcttggtgatgccggcgatgtggcgtttgag
gcaaaaaaaaggcagagcttcaccttgatcaagcctaaaccattgagtataaaaggcgtc
tatcaatctctgataaagatcgctatgagcaagggcagcggaagtcaagaattgaaacaa
cgtatcgtggagaagcttttacaggacactcgaggtgcagaagaaagtcggtacatcgtg
aggaccctcgtccagaacttgcgtatcggtgctgtaaagacgactatgcttattgcgctt
gccagagccttcctagtctccaaaccagataatgcaacttttactgtgcatagtcaacac
gaactagctcgcctcaagaaggaagaactcgcagaaatctatagcagcgcagaggagctg
gtcaaagcgtcttatgccagacatccgaattacaacgaccttgtgccctgccttctcgag
atcggagtcaccgaggaacttctgctacggtgcgggttgcagcttcatatcccactgatg
ccaatgttgggtagcattactcgcgatctctcggaaatgttgacaaaacttcaggggcga
gatttcacctgtgagtttaagtacgatggacaacgtgcccaggtacactgcgacgaggca
ggcaaagtctcgatattctcccgacatctagaagaaatgacagaaaagtaccccgatctt
gtgtctcttgttcctcaaatacgaggagaaggtgtttctagcttcatcctagaaggtgaa
gtggttgccgtcgatcaaaacggagagctccaaccttttcagattttgaccaaccgagcg
aagaagaatgttgacattggggaaatcaagatcaatgtttgtctttttgcctttgatttg
atgtacttgaacggcgcacccctgctggaacggtctctgcgcgagcgaagagaattgctg
cgaagtctctttatggagataccgaaccgctttacatgggtcaaaagcctcgatgctacg
tcagccgattccgaagccgttctggactttttcaagagtgccacagagaacaagtgcgag
ggtataatggtcaaggtgctcgacaatacgcttgccactaatgggtccgacagcaccaac
tctagcatcactgcaacgccgaaagcagaagcaaaggaaacgaagaaaggtggccgtcga
aaagctttattgtcctcgtacgagcccgacaaacgactcgaatcctggctgaaggtgaag
aaagattacagcgcctcatcagaaacattggaccttatcccagtggccgggtggcatggc
aacgggcgaaaggcaaaatggtggtcgccgatcctccttgctgtgcgcaaccccgaaact
ggaggcctccaagctgtgacaaagtgcatgtccggcttcagcgataagttttaccaagcg
aataaggaaaaatacgaggaggggagtcctaatgtgatatcgcggccgagctacgtcgag
tataatggtgagccggacgtgtggttcgaaccacaagaagtctgggaaatggcatttgca
gatatcacgctcagcccgacttatccagctgctattggcttgaggttttcggaccgctcc
ctacagggaatttccccgatgcctgtcgacgatctgcagctttgttaccgttggcaagag
aacgtcaagggccgaatattagccgagcgtgcgtctgcagaatcaattgtagcgacgcaa
ttgaagcggccatatgtggccctaatgaatatcatcgactatcaaacgtga

DBGET integrated database retrieval system