KEGG   Aspergillus nidulans: AN5028.2Help
Entry
AN5028.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K17862  linoleate 10R-lipoxygenase [EC:1.13.11.62]
Organism
ani  Aspergillus nidulans
Pathway
ani00591  Linoleic acid metabolism
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Lipid metabolism
   00591 Linoleic acid metabolism
    AN5028.2
Enzymes [BR:ani01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.62  linoleate 10R-lipoxygenase
     AN5028.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase p450
Motif
Other DBs
NCBI-GeneID: 2872828
NCBI-ProteinID: XP_662632
UniProt: G5EAZ5 A0A1U8QTX2
LinkDB All DBs
Position
III
AA seq 1117 aa AA seqDB search
MLRRFSTFRKSKGDKTEKADRDSKANGSNANSAAAASNSSKRQSKVPPPRRPSSDSGSSA
ESEDVPAVFEKYAQVLHASSRPIPHQGGEAAYLEKEHPSGLFNDLKSLGFKDFASLKDVI
KTKINGELTDDKTMIMERIIQIVSSLPSNSKMRVDLTNMFLDELWGSLPHPPLSYMGNDY
QYRSADGSNNNPTLPWLGAANTAYARSIEPLTVQPGGLPDAGLVFDTLFARQKFTPHPNK
VSSLFFDWASLIIHDIFQTDYRDYNKNKTSAYLDLAILYGDVQEEQDLVRTHKDGKLKPD
SFSEPRLQAFPAACCVLLVMLNRFHNYVVEELAAINENGRFTKPSPDLPEEQAKKAWAKY
DEDLFQTGRLITCGLFINITLYDYLRTIVNLNRVNSTWCLDPRAQMEGSATPAGLGNQCS
VEFNLAYRWHSAISANDEKWTEKVYEELIGKPGSEISTQELLMGLGKYGASLPKDPSQRT
FAGLKRQEDGTFKDEELVNILTSAIEDVAGSFGARNVPKVLKAVEVLGIEQGRKWNVGSL
NEFRKFFGLKNYETFEEINSDPEVAESLRALYGHPDYVELYPGIVSEEAKEPMIPGVGIA
PTYTISRAVLSDAVALVRGDRHYTVDYNPRNLTNWGYNEVRYDLNINQGCVFYKLATRAF
PNWFKPDSIYAHYPMTIPSENKVIMKNLGREADYSWDRPQYQAPRASLTSYSNVKLILDQ
QKDFRVVWGDCTPLHSGKGGEDFWSKTLSDPQFKKSIKEFYEKTTLELFADKSVNLAGRK
QIDIVKDVGNIVPARFASKLLSLPLRSKENSKGVFTDHEIFMALAVIYNAIFFDVDTTKS
FPLRKAADAVSKELGKHVESHVKSVSSPGFLSRVIDNFRDDHNALKDLGDQLIKRLAEGG
LSVSDITYGQILPTAVELVHGQAQMFTRVVEYYLNEGKQHLPELSLLAKQDSAETDAKLT
RYALEAIRLNAGSGAYRKAETNFYFKEGDADINLKPGDEIFISSTQANRDPTAFPDPDEV
RLDRPDESYLNYGIGSQIGLGKDATLTAVTAMVRAAFSLEGLRPAPGVQGVLKKVVRPEG
YTLYMREDHGAFSPFPTTFRVHFDGEVVTPKKQIDSA
NT seq 3354 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgaagattttctaccttcagaaagtccaagggggacaagaccgagaaggccgac
cgcgattctaaggccaatggctccaatgccaatagcgccgctgcggccagcaacagcagc
aagcgccagtccaaggtgcctcctccgcgcaggccctcttcagacagcgggagcagcgct
gagagtgaagacgtccccgctgtctttgagaaatacgcgcaggtgcttcatgcctcctct
cgcccaatcccccaccagggcggagaggcagcatatctcgagaaggagcacccttcaggc
ttgttcaatgatctgaaatctctcggtttcaaggactttgcctcattgaaggacgtgatc
aagaccaagatcaatggcgagctcacggatgacaagaccatgatcatggagcgcatcatt
cagatcgttagcagccttccctcaaactcgaagatgcgcgtggacctcacgaacatgttc
ctcgacgagctctggggttctttgcctcaccccccgctctcatatatgggcaacgactac
cagtaccgctctgctgatggttctaacaacaaccccactcttccatggcttggtgccgct
aacacagcttacgcacgctccattgagcccttgaccgtgcaacccggcggtcttccggac
gctggtttggtctttgatactttgtttgcgcgccagaagtttacgcctcatcccaataag
gtgtctagtcttttcttcgactgggcgtctctgatcattcacgatatcttccaaaccgac
tacagagattataataagaacaagacctcggcttacctcgatcttgccattctctacggt
gacgtacaggaagaacaggacctggtccgtactcacaaggacggaaagctgaagccagac
tccttctccgagccgcgactgcaggctttccccgcagcttgctgcgttcttctcgttatg
ctaaacaggttccacaactatgttgtagaagagcttgctgccatcaacgagaacggtcgc
ttcactaaacccagccctgatctccccgaagagcaagcaaagaaggcctgggctaagtac
gatgaggatcttttccagaccggacgactcattacctgcggcctgttcattaacatcacc
ctgtacgattaccttcgcacgatcgtcaacctgaaccgagtgaacagcacctggtgcttg
gaccctcgagctcagatggaaggcagcgctacacctgccggtctcggaaaccaatgttct
gtcgagtttaacctggcctaccggtggcactctgctatcagtgccaacgacgagaaatgg
accgagaaggtctacgaggaactgatcggcaagcctggttcggagatcagcacgcaggag
ctgcttatgggtcttggcaagtacggtgctagccttcccaaagatccatctcagcgcacc
tttgcgggacttaagcgtcaagaagatggtacctttaaggatgaggagctagtcaatatc
ctgacttccgccattgaggatgttgctggttcgtttggtgctcgaaatgtgcccaaggtc
ctcaaggccgttgaggttctcggtatcgagcagggccgcaagtggaacgttggatctctt
aacgagttccgaaagttcttcggtttgaagaattacgagaccttcgaggagatcaactcc
gaccctgaggtcgccgagtcacttcgagctttgtacggtcaccctgactacgtcgagctg
tacccaggtattgtctctgaggaggccaaggaacccatgatccccggcgtcggcatcgcc
cctacttataccatctcccgcgcggttctgtccgatgcggttgcgctcgtgcgcggtgac
agacactacactgtcgactacaacccccgcaacctgaccaactggggttacaacgaggtc
cgctacgatcttaacatcaaccaaggctgtgtcttttacaagctcgccactcgcgcgttc
cccaactggttcaaacccgactctatctacgcccactaccctatgaccattcccagcgag
aacaaggtcatcatgaagaatctcggccgagaggctgattactcctgggaccggccgcag
taccaggctcctcgcgctagcttgacctcctactctaatgtcaagctcattcttgaccag
cagaaggacttccgtgtggtctggggcgactgcactccgctccactctggcaagggcggc
gaagacttctggagcaagacgttaagtgaccctcagttcaagaagagcatcaaggagttc
tacgagaaaacgactctggagcttttcgcggacaagtcggtcaacctagccggaaggaag
caaattgacattgtcaaagacgttggcaacatcgtgcccgctcgatttgcgtcgaagctt
ctctctcttcctctgaggagcaaggagaactccaagggcgtcttcaccgaccacgagatt
ttcatggctttggctgtgatttataatgccatctttttcgacgttgacaccacaaagtca
ttccctcttcgcaaagctgcagacgctgtttccaaggaactcggcaagcacgtcgagagc
cacgtcaagtccgtcagctctccaggcttcctttccagagtcattgacaacttccgtgat
gaccacaacgctctcaaggatcttggtgaccagctcattaagcgcttggcagagggtggt
ctcagcgtctcggacatcacctacggccagatcctgccgacagctgtggaactggtccac
ggccaggctcagatgttcacccgagttgttgagtactatctcaacgagggcaagcagcac
ctacctgagcttagcctccttgccaagcaggactctgccgagacggatgcgaagctgacc
cgctacgctctggaggctattcgcctgaatgccggctcgggagcttaccgcaaggccgag
accaacttctatttcaaggagggggacgcagatatcaacctcaaacctggggacgagatc
ttcatcagctcgacccaagcaaaccgtgacccaacggccttccctgaccctgatgaagtg
cgccttgaccgacccgatgagtcctacctcaactacggcatcggttctcaaatcggcctc
ggcaaggacgccacactgaccgcagtcactgccatggtacgcgccgccttcagcttggag
ggtctccgtccggctcctggtgtacagggagtcctgaagaaggttgtccgccctgaaggc
tacaccctctacatgcgggaggaccacggtgctttttcgcctttcccgacgactttccgt
gtgcacttcgacggagaagttgtcactcctaagaagcagattgattctgcttga

DBGET integrated database retrieval system