KEGG   Aspergillus nidulans: AN5447.2Help
Entry
AN5447.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ani  Aspergillus nidulans
Pathway
ani00250  Alanine, aspartate and glutamate metabolism
ani00410  beta-Alanine metabolism
ani00430  Taurine and hypotaurine metabolism
ani00650  Butanoate metabolism
ani01100  Metabolic pathways
ani01110  Biosynthesis of secondary metabolites
Module
ani_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ani00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AN5447.2
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AN5447.2
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AN5447.2
   00430 Taurine and hypotaurine metabolism
    AN5447.2
Enzymes [BR:ani01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AN5447.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 zf-RAG1
Motif
Other DBs
NCBI-GeneID: 2871735
NCBI-ProteinID: XP_663051
UniProt: A0A1U8QKD6 Q5B1Y3
LinkDB All DBs
Position
V
AA seq 515 aa AA seqDB search
MVHLASIKKDDDFEPVVNRVDSIKLDTIEEDDYSATVYGTRFATQQLPHAEMPDREMPRE
VAYRMIKDELSLDGNPMLNLASFVTTYMEDEAEKLMAESFSKNFIDYEEYPQSAEIQNRC
VNMIARLFNAPTDSDTDHPMGTSTVGSSEAIMLGTLAMKKRWQNKRKAEGKDYSRPNIVM
NSAVQVCWEKAARYFDVEERYVYCTEERYVIDPQQAVDLVDENTIGICAILGTTYTGEYE
DVKAINDLLVERGLDCPIHVDAASGGFVAPFIHPTLQWDFRLEKVVSINVSGHKYGLVYP
GVGWVVWRSPEFLPKELIFNINYLGAEQASFTLNFSKGASHVIGQYYQMIRLGKRGYRSV
MVNITRIADYLADQLEQLGFIIMSQRRGRGLPLVAFRLPADRADETFDEFAIAHQLRERG
WIVPAYTMAPHSNNLKLMRVVVREDFSMSRCDQLLSDIKLALKSLREMDQAMLERYTQHV
RSHTTKSHRAKHTHPHYKNETHSLQGRTGKTHGVC
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggttcatctcgcatccatcaagaaagacgacgacttcgagcctgtcgtcaaccgcgtc
gattccataaagctcgacaccattgaagaggatgattactcggccaccgtctatggtacg
cgttttgcaacccagcagctgcctcacgccgagatgccagatcgtgagatgcctcgcgag
gtggcttatcgtatgataaaggatgagctgagcttggacggtaacccgatgctgaacttg
gcgagttttgtcactacttacatggaagatgaggccgagaaactcatggccgaatcgttc
agcaagaactttatcgactatgaagagtaccctcagtccgccgagattcagaaccgatgc
gtcaacatgatcgcccgtttattcaatgctcccacggacagtgacaccgaccacccaatg
ggcacctccactgtcggctcgtcagaggcgatcatgctgggcactctggcgatgaagaaa
cggtggcagaacaagcgcaaggcagaagggaaggactactcgcggcccaatatcgtcatg
aacagcgctgtccaggtttgctgggagaaggcagcccgctatttcgatgttgaggagcga
tatgtatattgcacggaggagcgctacgttattgatcctcagcaggcggtggaccttgtt
gacgagaataccatcggtatctgcgccattttgggcacaacatacaccggagaatacgag
gacgtcaaggcgatcaacgaccttttggtcgagcgcggcctggactgcccaatacacgtc
gatgccgctagtggtggcttcgttgcccccttcatccacccaaccctgcaatgggacttc
cgtctggagaaggtcgtctcaatcaacgtctccggccacaagtacggcctggtctacccc
ggtgttggatgggtcgtctggcgatcgcctgagttcctacccaaggagctcatcttcaac
atcaactatctcggcgctgagcaagccagtttcacgctaaacttctctaagggcgcttca
catgtcattggccagtactaccagatgattcggctgggcaagcgaggataccgctcggtc
atggtgaacatcacccggatcgcggattatctagctgaccagctcgaacagctcggcttt
atcatcatgagccagcgccgcggtcggggactgcctctagttgcgtttcgcctccctgcg
gaccgggcggacgagacattcgatgaattcgcgatcgcgcaccagctgcgcgagcgagga
tggattgtgccggcttacactatggcgccacacagtaacaacctgaaattgatgcgcgtc
gtggtacgtgaggacttttccatgagccggtgcgatcagctcttgagcgatattaagctg
gccctaaaaagcctgcgtgaaatggatcaggcgatgttggaaagatatacgcaacacgtt
cgctcgcatacaaccaagtcgcatcgggcaaagcacacgcatccacactacaagaatgaa
acgcactcgctgcagggcaggacaggcaagacgcacggggtttgttaa

DBGET integrated database retrieval system