KEGG   Aspergillus nidulans: AN5560.2Help
Entry
AN5560.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
Organism
ani  Aspergillus nidulans
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_5 GST_C_3
Motif
Other DBs
NCBI-GeneID: 2871852
NCBI-ProteinID: XP_663164
UniProt: Q5B1M0
LinkDB All DBs
Position
V
AA seq 647 aa AA seqDB search
MDDLGLRSPDSLRPLQPLLSSVAENASNLAASVKHQQYNDHEDHQHEHNLEVAVEARSLQ
PLQSAIADYDHYELHQQKHQHQNQDQSEERQFRPEDAYGSLTNQSASLRIQRPQNTSESI
FSSKEHGYLRDVASIANPPDLEAWRDRLFDVDEMIVMSEEEFRTYFPHVDNVYSHRSTQH
YKRKPLVSHYWDCRLKGRPPGTPKSDDPNKKKRKRTARQRDLCDVKIKITEYFPGYAVGL
GTGAGAGVGGAEGLGSAEQQQQFSLPFSPNGVGVDTPITTGESLPGVNTLLQFPSSAGSG
SFVPGNPAGRGELHNQNASQSQNQPFGVLTPNPPLPEGHPGAGGQRFFTIQRVNGNGANG
KNDGVSGGHRHTLEESDRVKKNSVQRFLLKEARERKKALSVTTRTMSAPKSYHTQATGAA
AETVANHSKESDLKLYGSCFCPFVQRVWIALELKGLPYQYIEVDPYKKPQSLLDVNPRGL
VPALRHGEWGSYESSVLLEYLEDLEVGPPLLPPGDAKLRAHCRLWTDFVNRHIVPSFYRV
LQEQDQQKQIEHAHELHSSFNTLIEVADPEGPFFLGPDLSFVDVQVAPWIIRLNRVLKPY
RGWPDPEPGTRWSAWVNAIEANDSVKATTSLPDLYLDSYERYAGECP
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atggacgatctgggcctgcgatcccctgactcccttcgtcctctccagccgttactttct
tccgtcgcggaaaacgcgtcgaacctggctgccagcgtgaagcaccaacaatataacgat
cacgaagaccaccagcacgagcataatcttgaagttgccgtagaagcgcgatctttacag
cctctgcaatctgcaattgcggattatgaccactatgagcttcatcagcaaaagcatcag
caccaaaaccaggatcaatcggaggagcgacagtttcggcctgaagatgcgtatgggtcg
ttgacgaaccaatccgcatccctgcgcattcaacgaccccaaaacaccagcgagtctatc
ttctcctccaaagagcacggttacctccgcgatgtcgcgtcaatagctaatccacctgat
ttggaagcttggagagaccgtctcttcgacgtagacgagatgattgtgatgagcgaagaa
gaattccggacctactttccacatgttgacaacgtctactcccaccgctcaacacaacac
tacaagcgcaagcctctcgtttcgcactactgggactgccgcctaaagggccgaccaccg
gggacgcccaaatccgatgaccccaacaagaagaaacgcaagcggacggcgcggcagcgg
gatctctgcgacgtcaagattaagattactgagtacttccctggctatgcggtggggctt
ggcactggcgctggcgctggtgttggtggtgcggaagggttaggctcagccgagcagcag
cagcagttctctctacccttttctcctaacggcgttggcgtcgacacgccgattacaact
ggcgagtcactacctggtgtgaatacactacttcagtttccgtcttccgccggtagtggt
agtttcgtccctgggaatccagctgggaggggagagctgcacaaccaaaatgcgagccag
agccagaaccagccgtttggcgtcctcacgccaaacccgcctctaccagaagggcaccca
ggagcaggtgggcagcggtttttcacaattcagcgcgtgaatgggaacggagcgaatggg
aaaaacgatggggtgagcggagggcaccgtcatacgctcgaggaaagcgatcgagtgaag
aagaacagcgtgcagcgatttctgctaaaagaggcaagggagaggaaaaaagcattgtcg
gtgactaccaggacaatgtccgccccgaaaagttaccacactcaagccaccggcgcagcg
gctgagacggtagcgaatcactccaaagaatcggatttgaagttgtacgggagttgcttc
tgccctttcgtgcagcgtgtctggattgccctggagctcaaaggccttccttaccagtat
attgaggttgacccatataaaaagcctcaatcattgctcgatgtgaacccaaggggcctg
gttccagcattgcggcatggtgaatgggggtcgtatgagagctctgtgttgctcgaatat
cttgaggatttagaggttggccctcctctccttcctccgggtgatgcgaagctgagagcg
cactgtcggctgtggactgactttgtcaaccgtcacattgtccctagcttctatcgcgtg
ctccaagagcaagatcagcagaagcagattgaacatgcacatgaactccatagctcattc
aacacgttaatagaagtcgccgaccccgaaggaccgttctttcttggaccggatctctct
tttgtggatgtccaagttgcgccctggataatccgcttgaaccgcgttttgaaaccatac
cgtggttggccggacccggaaccaggaactcgatggagcgcttgggtgaacgctatcgag
gccaatgatagcgtcaaggcgacgacgagcttgccggatctttatcttgacagctatgag
cgctatgccggtgagtgtccttag

DBGET integrated database retrieval system