KEGG   Aspergillus nidulans: AN5571.2Help
Entry
AN5571.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ani  Aspergillus nidulans
Pathway
ani00020  Citrate cycle (TCA cycle)
ani00310  Lysine degradation
ani00380  Tryptophan metabolism
ani01100  Metabolic pathways
ani01110  Biosynthesis of secondary metabolites
ani01130  Biosynthesis of antibiotics
ani01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ani00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AN5571.2
  09105 Amino acid metabolism
   00310 Lysine degradation
    AN5571.2
   00380 Tryptophan metabolism
    AN5571.2
Enzymes [BR:ani01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     AN5571.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 2871865
NCBI-ProteinID: XP_663175
UniProt: A0A1U8QPE7 Q5B1K9
LinkDB All DBs
Position
V
AA seq 1048 aa AA seqDB search
MFRSTAMKATVRGAACSSCRRSMSLASTVRRADSSSKFGLATRRPLALVGKRFYASSAED
SGVAASDSFLSGNTANYIDEMYVAWRKDPSSVHISWQTYFRNMEEGKMPISQAFQPPPTL
VPTPTGGVHQEMPGAGLGLSQGTDVTKHLKVQLLVRAYQARGHHKAKIDPLGIRGEAEAF
GYSKPKELELDHYGFTERDLDEEFDLGPGILPRFATEGRKKMSLREIIAACEKIYCGSYG
VEYIHIPDRKPCDWIRDRFEVPEPYKYSVDDKRRILDRLIWSSSFEAFLATKFPNDKRFG
LEGCETLVPGMKALIDRSVDYGIKDIVIGMPHRGRLNVLSNVVRKPNESIFSEFAGSAEP
SDEGSGDVKYHLGMNFERPTPSGKRVQLSLVANPSHLEAEDPVVLGKTRAIQHYNNDEKN
FDSAMGVLLHGDAAFAAQGIVYETMGFHSLPAYSTGGTIHIVVNNQIGFTTDPRFARSTP
YCSDIAKSIDAPVFHVNADDVEAVNYVCQVAADWRAEFKRDVVIDIVCYRKQGHNETDQP
SFTQPLMYKRVAEKKLQLDMYVEKLISEGTFTKEDIDEHKKWVWGMLNDSFDRSKDYQPT
GKEWLTSAWNGFKTPKELATEVLPHLPTAVEPPILKNVADKISGAPEGFTLHRNLKRILG
NRKKTVEEGKNIDWATAEALAFGSLVSEGYHVRVSGQDVERGTFSQRHAVLHDQETEATY
TPLQHISKDQGSFVISNSSLSEFGALGFEYGYSLTSPNALVMWEAQFGDFANNAQCIIDQ
FIASGESKWLQRSGLVLSLPHGYDGQGPEHSSGRMERYLQLCNEEPRVFPSQDKLDRQHQ
DCNMQVAYMTSPANLFHLLRRQIHRQFRKPLVIFFSKSLLRHPLARSSIEEFTGDSHFQW
IIPDPAHGTAIDEPEKIERVILCSGQVYAALTKHREANNIRNTAITRVEQLHPFPWAQLK
ENLDSYPNARNIVWAQEEPLNAGSWSYVQPRIETLLNETEHHNRRHVMYAGRPPSASVAT
GLKSVHVKEEQEMLEEAFSVHQERLKGE
NT seq 3147 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgttctaccgccatgaaggcgaccgtgcgcggtgctgcctgctcttcatgtaga
cggtcaatgtctctcgcttctaccgtcagacgtgccgactcgagctcaaaatttggccta
gctacccgacgacctctcgcccttgttggcaagagattctatgcctcgtctgccgaggat
tctggcgtggccgccagcgactcctttctctcaggaaacaccgccaactatattgatgag
atgtacgtcgcatggaggaaagacccttcaagcgtccacatctcgtggcagacgtatttc
cgtaacatggaggagggcaaaatgccaatctcccaggccttccagccccctcctaccctc
gttccgacgcccactgggggcgtccaccaggagatgcccggtgctggtctcggtctttcc
caaggcactgatgtcacaaagcacctgaaggtccaactacttgttcgcgcataccaggct
cgcggtcaccacaaggctaagatcgatcccctgggtatccgtggcgaagctgaagccttt
ggttacagcaagcccaaggagctcgagctggaccattacggcttcaccgagcgcgatcta
gatgaggagtttgaccttggtccaggtattcttccccgcttcgctactgagggccgtaag
aagatgtctctccgtgagatcattgctgcttgcgaaaagatctactgtggctcgtacggc
gtggagtatattcacatccccgaccgtaagccttgcgattggattcgtgatcgtttcgag
gtcccggagccctacaagtactccgtcgatgacaagcgccgcattctcgaccgtctcatc
tggagttctagctttgaggctttcctggctaccaagttccctaacgataaacgtttcggt
ctggagggttgcgaaacccttgtgcctggtatgaaggctttgatcgaccgcagtgtcgat
tatggtatcaaggacatcgtcatcggtatgccccaccgtggtcgtctcaacgtcctgtcc
aatgtcgttcgaaagcccaatgaatccatcttcagtgagttcgccggttctgccgagcct
tccgatgagggctctggtgatgtcaagtaccaccttggcatgaacttcgaacgccccacc
ccctctggtaagcgtgtgcagctctctcttgttgcaaacccgtcccatctcgaagccgag
gaccccgtcgtcttgggtaagacccgcgctatccagcactacaacaatgatgagaagaac
ttcgatagcgccatgggtgttttgctgcacggtgatgctgcgtttgctgctcagggtatt
gtctatgagaccatgggcttccactccttgcccgcctactccactggaggaactatccac
atcgtcgtgaacaaccagattggtttcaccaccgatcctcgctttgctcgctctacacct
tactgctcagacatcgccaagtcgattgatgcgcctgtcttccacgtcaacgctgatgac
gttgaggctgttaactacgtctgccaggtcgctgctgactggcgcgccgagttcaagcgt
gacgttgtcattgatattgtctgctaccgtaagcagggtcacaacgagactgaccagccc
tctttcacccagcctctaatgtacaagcgcgttgctgagaaaaagcttcagctcgacatg
tacgttgagaagctcatttccgagggcaccttcaccaaggaggacattgacgagcacaag
aagtgggtctggggcatgctcaatgacagctttgaccgaagcaaggactaccagcccacc
ggtaaggagtggctgacctccgcctggaacggtttcaagactcccaaggagcttgccact
gaggtgctgccgcatcttcccaccgctgtcgagcctcctattctgaaaaatgtcgccgac
aagatcagtggtgctcctgaaggcttcactcttcaccgcaacctcaagcgtattctgggc
aaccgcaagaagaccgttgaggagggtaaaaatattgattgggctactgccgaggctctt
gccttcggttccctcgtcagcgagggttaccacgtccgtgtgtccggtcaggatgttgag
cgtggtactttctctcagcgtcatgctgttctccacgaccaggagactgaggcgacttac
acccctcttcagcacatcagcaaggaccagggtagctttgttatttctaactcgtctctg
agtgaattcggagcccttggcttcgagtatggttactctttgacctctcctaacgccctt
gttatgtgggaggctcagttcggtgactttgccaacaacgctcagtgtatcatcgaccaa
ttcattgcctctggagaatccaagtggctgcagcgctccggtttggtcctgtctcttcct
catggttacgacggtcagggccctgagcactcttccggtcgtatggagcgttacctccag
ctctgtaatgaggagccccgtgtcttcccctcccaggacaagctcgaccgccagcaccag
gactgcaacatgcaggttgcttacatgaccagccctgcgaacctgttccacttgctgcgt
cgccagatccaccgtcaattccgcaagccccttgtgatcttcttctctaagtctctcctt
cgtcacccacttgctcgctcctctattgaggagttcactggcgactctcacttccaatgg
atcattcccgaccctgctcatggaaccgccatcgatgagcctgagaagattgagcgtgtc
attctctgctctggccaggtgtacgctgccctcaccaagcaccgcgaagccaacaacatc
cgcaacactgccatcacccgtgttgagcagctgcatcccttcccttgggctcagttgaag
gagaaccttgacagctaccccaacgctcgcaacattgtgtgggctcaggaagagcccctg
aatgccggttcatggagctacgtccagcctcgcattgagactctgcttaacgagaccgag
catcacaaccgccgccacgtcatgtatgctggtcgcccgccaagtgcttccgtagccacc
ggcttgaaatccgttcacgtgaaggaagagcaggaaatgctcgaggaggctttctccgtc
caccaggagcgtttgaagggcgagtag

DBGET integrated database retrieval system