KEGG   Aspergillus nidulans: AN6388.2Help
Entry
AN6388.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
ani  Aspergillus nidulans
Pathway
ani00052  Galactose metabolism
ani00511  Other glycan degradation
ani00600  Sphingolipid metabolism
ani01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AN6388.2
  Lipid metabolism
   00600 Sphingolipid metabolism
    AN6388.2
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AN6388.2
Enzymes [BR:ani01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     AN6388.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_2_C DUF4982 Glyco_hydro_2_N Glyco_hydro_2 BetaGal_dom4_5 Invasin_D3
Motif
Other DBs
NCBI-GeneID: 2871287
NCBI-ProteinID: XP_663992
UniProt: A0A1U8QLD7 Q5AZ92
LinkDB All DBs
Position
I
AA seq 891 aa AA seqDB search
MKLQSCAYLGWGLALAASSAVALSVRNTNKAPSQSVRERASLNHQWKFWHSEQIPDNIVY
DLRPDANDSSFQVLKSWVLPVGNDYIKNANAQHERPSTEPDGDIPYVHNDFDDSSWDVVR
LPHDWAITRPFYTDDDPEIPSAMGRLPVQGVGWYRRKLNFTQEDSDKVVLLEIDGAMSYP
MVWLNGHLVGGWPYGYNSFQLDLTPYLQQGEENQLAIRVENPSGSSSRWYPGGGIYRNVW
LTKVNPTHVAHYGTKMTTRDVSSRRATIDFQVQIENKGQKRQRVEVATEIFDLDSANGHV
RGRKVEQFPRHKVIVDKDNPRLWGPPPDQTPNLYIAVTSLYDASGHLLDTYSTEFGVRSV
EYNPNTGLSVNGAPVRIQGVNQHHDLGALGAAFNRRAAQRQLELLCDLGVNAIRTAHNPP
APELLEMTDRMGFLVLDEIFDSWAQQKTDLDFHLIFNDWREPDLRSFLRRDRNHPSVIIW
SIGNEVAEQSADDTAAAIATYLRDIVREEDNTRPVTASMNSAWPNSSFAGVVDLISLNYQ
GEGLRYGPAYSHLEGNRRDPQYSEFHVTHPDKLILGSEVAWSLSTRGTFLFPVTNYTSAP
VNDTSGGNSTTLEISAYELYSSDPGSSPDRVFATQDEHPFVDGGFVWAGWDYLGEPYPYY
DGARSAYSGIIDLAGFKKERFYLYQARWQPDVRMAHIVPHWSWPERVGQVTPVHVFTSGD
EAELFVNGVSQGRLKRDPLTYRFRWDEVVYEPGEVQVVAYKNGSKWATDTVKTAGEPTQL
RLTPDRAQIAADGEDLSFVTLEVLDGKGNVVPEAKNLIHFEVSGPGEIVATDNGFPADYT
AFPSHERTAFHGLALCIVKGELGTHGDIVLKASSNGVGEAEVVIKASRGMP
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atgaaactccagtcttgcgcatatctaggatggggccttgcccttgcggcctcatctgcc
gttgcgctatcagtgcgcaacaccaacaaagctccctcgcaaagcgtgcgtgaacgagca
agtctcaatcaccaatggaaattctggcactccgagcagatcccagacaatattgtctac
gaccttcgtcccgacgcgaacgattccagttttcaagtattaaagtcctgggtcctgccc
gttggcaacgactatatcaagaacgccaatgcacaacatgaacgcccatctaccgaaccg
gatggcgacattccatatgtgcataatgattttgacgacagtagttgggatgtcgtgcgt
ctgcctcatgactgggctatcactagaccattttatacagacgacgaccccgagatacct
tcagctatgggtcgacttccagtgcagggggtggggtggtatcggcgcaagctgaacttt
acacaagaagacagtgataaagtggtcttgttggagatcgacggtgctatgtcttatccc
atggtttggctcaatggccatctggttggcggttggccatatggatacaattcgtttcag
cttgatctcactccatacctgcagcaaggggaagagaaccagcttgctatccgtgtggag
aatccatctgggagctcgtcaaggtggtatcctggtgggggaatttaccgcaacgtgtgg
ctgaccaaggttaatcctacacatgttgctcattacgggacaaagatgacgacgagggat
gtttccagccggagagcaacaatcgatttccaggtgcagatcgagaacaagggtcagaaa
agacagagggtagaggtcgctacggagatctttgaccttgactctgcgaatggccatgtg
cgcggtcgaaaagtcgaacaattccccaggcataaggttatcgttgacaaggacaatccc
cgcctatggggacctccaccggatcagacccccaatctgtatattgccgtcacttcttta
tacgacgcaagtggccacctactcgatacctacagcaccgaattcggagttcgttcggta
gagtacaatccgaacaccggcctctcagttaacggcgcgccagtacgtatccaaggcgtc
aaccagcatcatgacctaggtgctttaggagcggcgttcaacaggagagccgcacagcgg
caactggagctactgtgtgatctcggcgtcaatgcaatcaggacagcacataaccccccg
gcacccgagctcctagaaatgacggaccggatgggcttcctagtcctcgatgagatcttt
gattcctgggcacagcagaagactgacctggattttcatttgatattcaacgactggcgc
gagccagatctacgatcctttctacgtcgagatcgcaaccacccctccgtcataatttgg
agtattgggaacgaagtcgcagagcaatcggccgacgatacagccgcagccattgcgacc
tacctccgggatattgtaagagaagaagacaacacccgaccagtcacggcgtcgatgaac
agtgcatggcccaattcgtccttcgcgggtgtggttgatctcatcagccttaattaccaa
ggcgaaggtttacgatacggcccggcctattcacacctagagggaaacagaagggacccg
cagtacagtgagttccatgtaacgcatcccgacaaactcatcctggggagcgaggtcgcc
tggtcgctcagcacccgtggaacgttcctattccccgttacaaactacaccagtgcgcct
gttaatgacacctccggtggaaactcgaccacgctcgagatttccgcatatgaactctac
tcatccgaccccggctcatcacccgaccgcgtcttcgccactcaggacgagcaccccttc
gtcgatggcgggtttgtctgggccggatgggactacctgggtgagccgtatccatactat
gacggcgcaagaagcgcatactcagggataattgaccttgcggggttcaagaaggagcgc
ttctacctgtaccaggcacggtggcagccggatgtccgtatggcgcatattgtgccgcat
tggagctggccggaaagagttggacaggttacgccggttcatgtctttacctctggtgac
gaggcagagctctttgtcaatggggtgtcgcaggggaggctcaagagagaccccctgaca
tatcgatttagatgggacgaggtcgtctatgaacctggcgaggtgcaagtcgtcgcctat
aagaacggcagcaagtgggcaacagataccgtaaagacagccggcgaaccaacacaactc
cgtctcactcctgaccgagcccagatagctgctgacggcgaggacctctccttcgtgacg
ctggaagttctcgacggcaagggcaatgtcgtacctgaagcgaagaacctaatccacttt
gaagtctctggcccaggagagatagtcgctacagataatggctttcctgctgactacacg
gctttcccgtcccacgaacggacggcctttcacgggttggctttgtgtatcgtgaaaggg
gagcttggtacacatggggatattgtgcttaaggcatcaagtaatggggtcggagaggcg
gaggtggtaatcaaggcttcgcgaggtatgccatga

DBGET integrated database retrieval system