KEGG   Aspergillus nidulans: AN7345.2Help
Entry
AN7345.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
ani  Aspergillus nidulans
Pathway
ani00052  Galactose metabolism
ani00500  Starch and sucrose metabolism
ani01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ani00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AN7345.2
   00500 Starch and sucrose metabolism
    AN7345.2
Enzymes [BR:ani01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     AN7345.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 2869771
NCBI-ProteinID: XP_680614
UniProt: Q5AWI5
LinkDB All DBs
Position
IV
AA seq 875 aa AA seqDB search
MAGTLLSWTPLALALMARALSQLPLTDCPGYRVINVEERPRGLTADLTLAGTPCNVYGVD
IENLRLETDYDTNQRLHVKIYDADENVYQVPDSVFPRPVVNDQACADENTPELRFSYAED
PFSFAVSRASNDETLFNTTGHNLIFQSQYVNLRTSLPQNPNLYGLGEHSDPLRLNTINYT
RTLWNRDAYTIPAGTNLYGAHPMYIDHRGEAGTHGVFLLNSNGMDIKIDKNSDNIQFLEY
NILGGVLDFYFFAGPSPKDVSVQYAEVAGLPAMVPYWGLGFHQCRYGYRDIFEVAAVVHN
YSEARIPLETMWTDIDYMDHRKVFTLDRERFPLDTVRALVQYLHQRDQHYIVMVDPAVAH
SENGAFTRGLEKDVFMRKQDGTLYQGAVWPGATVFPDWFHPNTSDYWINEFALFFNAESG
VDIDALWIDMNEAANFCDWPCTDPVAYAEENNLPPEPPAVRPNPSSLPGFPAEFQPVNSN
NNNSSRKRETQVVIAARQGFVKVGNDNGNGRRLGLQGRELIDPPYKIANAAGSLSNKTMN
TDIFHANGLAEYDTHNLYGTMMSSLSRDAMLYRRPEKRPLVITRSTFAGAGSYVGHWLGD
NASTWTKYRISIAQMLAFASIFQIPMVGSDACGFTGNTTEELCSRWATLAAFNPFFRNHN
EYGMVSQEFYRWNSVAEAARKAISIRYSLLDYLYTEFHEQTVTGEPFLLPLFFVYPNDPN
VVGIDSQFFYGDAILVSPVIEEGLPLRGNGEVITLTDIGYTDIPLHVRGGKIVPVRTGSA
GMNTTTEVRKSGFRLVIAPGLDGRAAGRLYIDDGESLEQTAMVDVVFTYEDGRVSVDGVF
TLQTDLRVEAVTVFGDNVVERTIDLPLSGPGGVEL
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atggccggaactctcctctcatggactcccctggctctagctctgatggctagagctctc
agtcaattgcctttgaccgactgtcctggatacagggtgataaacgtcgaagaacgacct
cgcggactgacagcggatctgacactcgctggtacgccgtgcaacgtgtatggagttgat
atcgagaacctgaggctcgaaaccgactatgatacgaatcaaagacttcatgtcaaaatc
tacgatgcggatgagaacgtctaccaagtgcccgactctgtcttccctaggcccgttgtc
aatgaccaagcctgtgctgatgaaaacaccccggagctgaggttttcgtacgcagaagat
cctttctccttcgccgtctcccgagcgagcaatgacgaaacactcttcaatactacagga
cataatttaatatttcaatcccaatatgtgaatctccgcacctctctcccacaaaaccct
aatctctacggacttggcgagcacagcgatccccttcgcctgaacactatcaattatacc
cgcacactctggaaccgggatgcttataccatccccgcggggacgaatctttatggggcg
cacccgatgtatatagaccaccggggcgaggcaggaacgcacggagttttccttttgaat
tcaaacgggatggacatcaagattgacaaaaactctgataatatccagttcctggaatat
aatatcctggggggcgttctagacttttatttctttgctgggccaagtccgaaagacgtg
agcgtgcagtatgcggaggttgcaggcttaccagccatggttccatactggggtcttgga
tttcatcaatgccgttacggttacagagatatcttcgaagtcgctgcggtagtacataac
tatagcgaagcgagaattcccctcgaaacaatgtggaccgatatcgactacatggatcac
cgcaaagtttttacactcgatcgagagcgattcccattggatactgtccgagctttggtg
caatatcttcaccagcgagaccaacattatattgttatggttgatcccgcggtagctcac
tctgagaacggcgctttcacacgagggctagagaaggatgtgttcatgcggaagcaagat
ggaacgctatatcaaggcgctgtctggcccggtgcgacagtttttcccgactggttccat
ccaaacacttcagactattggatcaacgaattcgcgttgttcttcaatgcagaatcagga
gttgacatcgatgccctgtggatcgacatgaacgaggccgctaacttttgtgactggccc
tgtacagaccctgtcgcctatgcggaggagaataacctccctccggagccgccagctgtc
aggccaaatccgagcagccttccagggtttccggctgagtttcagcctgtaaacagcaat
aacaataacagtagcagaaaacgcgagacgcaagttgttattgcagccaggcaaggattt
gtcaaagtcggaaacgacaatggcaatggcaggaggctgggtctgcagggccgcgaactg
atcgatccgccctacaagatcgccaacgcagctgggtcgctgagcaataagactatgaat
acagacattttccatgccaatgggcttgctgagtatgatactcacaatctatacgggaca
atgatgagttcgctttcacgagacgccatgctctacagacgcccagagaaacggccccta
gtgataacgcgcagcacctttgccggtgcaggctcctacgtcggtcactggctcggcgac
aacgctagcacctggaccaaataccgcatctccatcgcccaaatgctcgccttcgcatcc
atattccagatccccatggtcggttctgacgcatgtggttttacaggcaatacgactgag
gagctgtgctcgcgctgggcaaccctggccgcttttaaccccttctttcgcaatcacaat
gagtacgggatggtctcacaagagttttacaggtggaactctgttgccgaggcagcaagg
aaggcaataagcatccgatacagtttgcttgactatctttacacggagttccatgaacag
acggtcacgggcgagccgtttttgctcccacttttctttgtctatccaaatgaccccaat
gtggtgggtattgactcacagttcttctatggggatgcgattcttgtcagtcctgttatt
gaagaaggtcttcctcttcgtggaaatggtgaggtgataacattgacggacattgggtac
actgacatcccgttacatgtacgtggtgggaaaattgtgcctgtacggaccgggtctgcg
gggatgaatacgacgactgaggtgaggaagagcgggtttcggttggtcattgccccagga
ctcgatggtagggctgcaggccgcctgtacattgatgatggggaatcgttggagcagact
gccatggtggatgtggtctttacctatgaggacggtagggtgagcgttgatggcgtgttt
acgctacagactgatctacgtgttgaggctgtgactgtgttcggggacaatgtggtcgaa
aggactatcgacctgcctctttccggaccgggaggtgttgagctgtag

DBGET integrated database retrieval system