KEGG   Aspergillus nidulans: AN7812.2
Entry
AN7812.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K17646  5'-oxoaverantin cyclase / versicolorin B synthase [EC:4.2.1.142 4.2.1.143]
Organism
ani  Aspergillus nidulans
Pathway
ani00254  Aflatoxin biosynthesis
ani01100  Metabolic pathways
ani01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ani00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    AN7812.2
Enzymes [BR:ani01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.142  5'-oxoaverantin cyclase
     AN7812.2
    4.2.1.143  versicolorin B synthase
     AN7812.2
SSDB
Motif
Pfam: GMC_oxred_N GMC_oxred_C DAO Pyr_redox_3 FAD_binding_2 NAD_binding_8 Pyr_redox_2 Lycopene_cycl Trp_halogenase Thi4 HI0933_like NAD_binding_9 TrkA_N FAD_binding_3
Other DBs
NCBI-GeneID: 2869564
NCBI-ProteinID: XP_681081
UniProt: Q5AV68
LinkDB
Position
IV
AA seq 616 aa
MPAWSLLVLSALPVVGMFAGQTTFFSSPWETLFGTAAEQHEAAMDGRIQGRGLLSSHFGW
YGWPGQTFDYVIVGGGTAGLAMAHRLSEDGSNSVAVIEAGGFYEIEAGNATEVPMFLFNY
FFDNGHVKNPLFDWYQYTEAQPANKDRGSKGAYQLWADRVGDDSYTWDNWLPFFKKSVQF
SGPLTNPRPANATASNDVSAFAATAEEEGPVQVAYPYLTNAISSWVDKALEKMGFPEAQG
FSNGQLLGRSYITHTIHPKTRRRDTASTSYLQTALRTSNSLNVITHTLVKKIDFDEEKRA
TGVVVNTGGFEWQIGAKKEVILSAGVMRSPQLLMVSGLGPRETLEKLDIPVLSDLPGVGQ
NMQDTIILGPTNPVKVESHSQLMGSKETLPRSIYEYNNFRTGLLTNPGQDYFAFEKHQPG
NLSEATAADIDKAFPADWPTFSYIALDDTFVPQYDGKNYFSMSAALLATFSRGTVTINTT
NTADNPVVDPRWLDDPRDKEMAVAAFRRCREIVASETMQQVIDGPELLPGFEYQTDEEIL
NYIAETSDAYYAGVGTCAMGKPDDPLAVLDSKARVRGVKGLRVVDASAFPFAIDGQPMAT
VYALAEKVAADIIAGN
NT seq 1851 nt   +upstreamnt  +downstreamnt
atgcccgcctggtccctcctcgtcctctccgccctcccagtggtgggtatgttcgccggt
caaacgaccttcttctcctcaccatgggagaccctttttggcaccgccgctgagcagcat
gaagcagcaatggacggccgcatccaaggccgtggcctcctcagctctcactttggctgg
tacgggtggccgggccaaaccttcgactatgtgattgttggcggcggcacagccggccta
gcaatggcccatcggctgtcagaggacggtagcaactctgttgcggttattgaggccgga
ggattctacgaaattgaggcagggaatgccactgaagtgccaatgttcctgttcaactac
ttttttgacaacggccatgtcaagaacccgctgtttgactggtaccaatataccgaagcc
cagccagctaacaaagacaggggctcaaaaggcgcatatcaactctgggctgaccgagta
ggcgacgacagctacacttgggacaattggctgcctttcttcaagaaaagcgtgcagttc
tcaggcccactgacgaaccctcgccccgccaacgcaacggcctcgaatgacgtctcagca
tttgcagcaactgcagaagaagaggggcccgtccaggttgcgtatccgtaccttacgaac
gccatttcgtcgtgggtagacaaggccctcgaaaagatggggtttcctgaagcccaggga
ttctccaacggccagctgctgggccgctcatacatcacgcatactattcatcctaagact
cgtcgacgggatactgcgtctacctcgtacttgcagacggcccttcggacgagtaatagt
ctgaatgtgattacacatactctggtgaagaagatcgactttgacgaggagaagcgagcg
acaggcgtcgttgtcaataccggcgggttcgagtggcagattggcgcaaagaaggaagtc
atcctgtcggcaggagtaatgagatctcctcagctgctgatggtctctgggcttggccct
agagagacactcgagaagctggacattcccgtcctgtctgatctccctggcgtcgggcag
aacatgcaggacaccatcatcctgggccccacgaaccctgtgaaagtcgagagccacagc
cagttgatgggcagcaaggagactcttcctcgctcgatctacgaatacaacaacttccgc
acaggcttgctcaccaacccggggcaagactactttgccttcgaaaagcaccagccagga
aaccttagcgaggcgactgctgccgatatcgacaaggcctttccggctgattggccgacc
ttctcatatattgcgctggatgacacatttgtgcctcagtatgacggcaagaactacttc
agtatgtcggctgcgctgctggccacgtttagccggggcaccgtcaccatcaacaccacc
aacacggccgacaaccccgtcgtggacccgcggtggctggacgacccgcgcgacaaggag
atggctgtggcagcgtttcgccgatgccgcgagattgtcgcctcagagacgatgcagcaa
gtcattgacggacccgagctgctgccggggttcgagtatcagaccgacgaggagatccta
aactacatcgccgagacttcggacgcgtactatgcgggagtcggcacatgtgccatggga
aaaccggatgatccgcttgcggtgctcgactcaaaggcaagggttaggggcgttaaagga
ctcagagttgtcgacgcgtctgcatttccgtttgcaattgacggccagcccatggcgact
gtctatgcattagcagagaaggttgccgctgatattattgctggaaattga

DBGET integrated database retrieval system