KEGG   Aspergillus nidulans: AN8689.2Help
Entry
AN8689.2          CDS       T01016                                 

Definition
(RefSeq) HXKG_ASPNG GLUCOKINASE (GLUCOSE KINASE) (GLK)
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ani  Aspergillus nidulans
Pathway
ani00010  Glycolysis / Gluconeogenesis
ani00051  Fructose and mannose metabolism
ani00052  Galactose metabolism
ani00500  Starch and sucrose metabolism
ani00520  Amino sugar and nucleotide sugar metabolism
ani01100  Metabolic pathways
ani01110  Biosynthesis of secondary metabolites
ani01130  Biosynthesis of antibiotics
ani01200  Carbon metabolism
Module
ani_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ani_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ani00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AN8689.2
   00051 Fructose and mannose metabolism
    AN8689.2
   00052 Galactose metabolism
    AN8689.2
   00500 Starch and sucrose metabolism
    AN8689.2
   00520 Amino sugar and nucleotide sugar metabolism
    AN8689.2
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    AN8689.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN8689.2
Enzymes [BR:ani01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     AN8689.2
Membrane trafficking [BR:ani04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    AN8689.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 2868549
NCBI-ProteinID: XP_681958
UniProt: Q5ASP1
LinkDB All DBs
Position
III
AA seq 489 aa AA seqDB search
MSTVVEEATRIARQFEYSPEQVQRGVKEYIREVEEGLSEEGTTLSQIPTFVTSVPNGTEK
GLYLAVDLGGTNFRVCSIDLHGNHTFSLTQSKIMIPREMMTSGSAKELFLFLARQIESFL
RIHHNEHFEAHLKRKIAGTAREEDLFDLGFTFSFPVRQLGINKGTLIRWTKGFDIPDAVG
QDVCALLQNAIEELNLPVRVAALVNDTVGTLMARSYTSPGETGTFLGAIFGTGTNGAYVE
KLNKITKMAKIEHSDYDKSTGEMIINAEWGSFDNHLSVLPTTEYDRQLDADSNNPGIQMF
EKRVSGMFLGEILRLVLLDLHKSQGLFKPASGSDVFIPESSSLYRQWGIDTSLLSIVEAD
KSKDFEQVKSALKDHLKVERASENDCKAVQTVVHAIGKRAARLAAVPIAATLISTGKLKE
ELVDIGVDGSLVEFYPNFEGYMREAMREVPEVGDAGDKKVRIGISKDGSGVGAALIALVA
SKEGTKPPL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgtccactgtggtagaagaggctacgcgcattgctcgccagttcgagtactcgccggag
caagtgcagcgcggagtgaaggagtacatcagggaggttgaggagggattgtccgaggag
ggcacaaccttaagtcagatcccgaccttcgtgacgtctgtgcccaatggcactgagaag
ggcttgtacttggccgttgaccttggaggcaccaacttccgagtctgctccatcgacttg
cacggcaaccataccttctccctcacgcagtccaagatcatgattcctcgcgagatgatg
acgtcaggatcagcaaaggagctcttcctctttcttgcgcgtcagatcgagtccttcctg
cgcatccatcacaacgagcattttgaggctcatttgaaacgcaagattgccggaacagcc
agggaggaggatttgtttgatcttgggttcacatttagctttcctgtgcgccagttggga
attaacaagggtacgcttattcgctggacgaagggcttcgacattcccgacgccgtaggc
caggatgtttgtgcgctcctgcaaaatgccatagaggaactgaacctccctgtgcgcgtg
gctgcgcttgtaaacgataccgtcggtacgctcatggctcgttcatacacgtctcctggc
gagactggaacttttctcggtgcgatctttggaacaggcacgaacggtgcctacgtcgaa
aaactcaacaagattaccaagatggccaagattgagcactctgattacgacaagtcaacc
ggcgagatgatcatcaatgctgaatggggtagcttcgataaccatctgagcgttctgccc
actacggaatacgatcggcagctggatgctgacagcaacaacccgggtattcaaatgttc
gaaaagcgcgtctctggtatgttcttgggcgagattctgcgtctggtcttgctcgacttg
cacaagtcccaaggtctctttaagccggcttcggggtcggatgtcttcatcccagagtcg
tcttccctctaccgacaatggggtattgacactagtcttctgagtattgtcgaggcagat
aagagcaaggatttcgagcaggttaaatccgcgctgaaggaccacctgaaggttgagcgg
gcgagcgaaaatgactgcaaggcagtccaaaccgttgttcatgctatcggcaaacgtgcg
gcccgcctggctgctgttcctattgccgccaccctcatttccacgggcaagctgaaggaa
gagctggtggacatcggcgttgacggcagcctggttgagttctaccccaactttgagggc
tatatgcgtgaagccatgcgcgaagttcctgaggtcggtgatgcgggagacaaaaaggtg
cggataggtatctcaaaggacggcagtggagttggcgcggctcttattgctctcgtcgca
agcaaagaggggacaaagcccccgctgtga

DBGET integrated database retrieval system