KEGG   Aspergillus nidulans: AN8825.2Help
Entry
AN8825.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
ani  Aspergillus nidulans
Pathway
ani00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ani00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    AN8825.2
Enzymes [BR:ani01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     AN8825.2
Chromosome and associated proteins [BR:ani03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     AN8825.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW
Motif
Other DBs
NCBI-GeneID: 2868338
NCBI-ProteinID: XP_682094
UniProt: Q5ASA5
LinkDB All DBs
Position
III
AA seq 980 aa AA seqDB search
MSTHDNADRQSEFVADAVTAMKLEQSENNTDAPILNGGGAAMKPDSKAASPEPLIKDERA
SSTFMKSRSSSRTPSSRTPLKKEHSDSEDIQEKRGDDASGTEKVGGGISVKMEPGQPPKL
ARSSSQKVVPRPPQLFLDLPDSTEEAQKTFEVIETCQYANKYMGYTEHAMECDCAEEWVL
VVVLAPSPSFRVPSQNPASSTNRACGEDSDCINRATKIECMGDCGCGPDCQNQRFQRREY
ANVAVIKTEKKGYGLRAEEDLRPHQFIFEYVGEVINEGPFHRRMRQYDAEGIKHFYFMSL
SKGEFVDATKKGNLGRFCNHSCNPNCYVDKWVVGEKLRMGIFAERHIQAGEELVFNYNVD
RYGADPQPCYCGEPNCTGFIGGKTQTERATKLSNATIEALGIEDADGWDTAVAKRPRKKK
MGEEDEEYVDSVQPKSLDESGVTKVMAALMQCKEKWIAVKLLGRIQRCDDERVRNRVVKM
HGYQILNSQLAMWKDDFNVVLQILDILDKFPRLTRNKIIDSKIESTIQPLTSCGDERVEQ
KATVLLQLWSTLEIGYRIPRMKRDPNAATPTVSQFHRRDDISDERQQRPRSRSRSRSIEA
PRGPAAQKRGGQGPRNQHHQGPRTFRRRFDPLPQGWFAAESNGRTYYYSARGDTTWTRPT
KPAPQPPPPPKESRDKALQSIIDGIMNAKEQTPKEKSGTPTTPQPSKPTPEGKDRQEKWR
SYSEEKQKKLYENTLYPHIKYVVDKFKHKLPKDDLKRYAKDVAKKLVNSDFKNNRVTDPT
KIDDKQQKKVKKFCKEFFDKAVAKHQAHEKRKAEKLAKEGSSDNKLATPVGGQSEGDGTP
DVKMSDDEGSTGREGTGSLKRKRDELSVGNTNTPDDTPTSSTKRQRSSTPPPPPPPAMNT
NDNNNDNDDMSVRSDEPDADADADEVVLVGNPTPPPPPPPPPQEDMRIPDADAETNGHNF
EGYGEMNRSHQAQIGIEGNV
NT seq 2943 nt NT seq  +upstreamnt  +downstreamnt
atgtcaactcatgacaacgcggaccgccagtcagaatttgttgccgatgcagtcactgcg
atgaaactggagcagtccgagaataacaccgatgctccgatcctcaacggcggaggcgcc
gcgatgaagcccgactccaaagccgcgtcgccagaacccctaataaaagatgagcgggca
tcctcgacctttatgaagtcgcgatcctcttcacgaacaccgtcttcacgaacaccgctc
aaaaaagaacactcagatagcgaagatatccaggaaaagcgtggggatgatgcgtcgggt
acagaaaaggttggagggggcatctcggtcaaaatggagccgggacagcctcccaagctt
gctcgtagctcctcacaaaaggtggttccgcgaccgccacagctgttcttggacttgccg
gatagtacggaggaagctcagaagacatttgaggtgatcgaaacctgccagtatgctaat
aaatacatgggctatacggagcatgctatggagtgtgattgtgcggaagaatgggtttta
gttgttgtccttgcaccatccccaagctttcgcgttccgtctcaaaatccggccagttca
acgaatcgagcatgtggagaggactcggactgcatcaaccgcgcgaccaagattgagtgt
atgggcgactgcggctgtgggccagattgccagaaccaacggtttcagcgcagggagtac
gcgaatgtggctgtcattaaaactgagaagaagggttatggtctccgcgcggaagaggac
ttgcgaccgcatcaattcattttcgagtacgtcggggaggtcatcaacgaaggcccgttc
caccgccgcatgaggcagtatgatgcagaagggatcaagcatttctatttcatgtccctc
agcaagggtgaattcgtcgacgcaaccaagaagggcaatctcgggcgtttctgcaatcac
tcgtgcaaccccaattgttatgtcgataaatgggtggtcggagagaagctccgcatgggt
atctttgctgaacgacacattcaagcgggtgaggaactcgtctttaactataatgtggat
cggtacggtgcagacccccagccgtgttactgcggcgaacccaactgcacaggctttata
ggcggcaagactcagactgagcgggcgactaagctgtcaaatgcgacgatcgaagctctg
ggcatcgaagatgccgatgggtgggatactgccgttgcaaagcggccgcgaaagaagaag
atgggtgaggaggatgaagaatatgtggacagcgtacaacccaaatcactggatgaaagc
ggcgttacgaaggtcatggcggctcttatgcagtgtaaggaaaagtggattgcagtcaag
ctcctgggtcgaatccaacgttgcgatgatgaacgcgtgcgcaaccgggtcgtgaaaatg
cacggctatcaaatccttaattcacaactcgccatgtggaaagatgatttcaacgttgtt
ctacagattctggacatcctggacaagttcccccgtctcacgcggaataagatcattgac
tccaaaattgagtcgacaattcagccactcaccagctgcggcgacgaacgagtcgagcaa
aaagcgactgtattgctgcaactctggtcgactctggaaattggctatcgaattccacgg
atgaagcgggatcccaatgccgctactccgactgtcagccagtttcatcgacgagatgat
atctcagatgagcggcagcaacgccctagatcacggtcacggtcgaggtcaattgaagct
cctcgagggccagcagcgcagaaacgaggcggccagggcccaagaaatcaacaccatcag
ggtcctcgaacgttccgacggcggttcgaccctctcccacagggctggtttgcggccgag
tccaatggccgaacatattactattcagctcgaggagacactacctggacgcggcccacg
aagccagcgccgcagccgccgccaccgccgaaagagtcgagggacaaagcacttcagagt
attattgacggtatcatgaacgcaaaggaacagacgcccaaggagaagagcggcacgcct
accactccgcaaccgtctaagcccacgccggagggcaaggacaggcaagaaaagtggagg
agctacagcgaagagaaacagaagaagctctacgaaaacacgctgtatccccacataaaa
tacgtcgttgacaagttcaaacacaagcttccgaaagacgaccttaagcgatacgcgaaa
gacgtagcaaaaaagctagtcaattcggattttaagaacaaccgggtcacagatcctact
aagatcgacgacaaacagcagaagaaggttaagaaattctgcaaagaattctttgacaaa
gcggttgcgaagcaccaggctcacgagaagcgaaaagcggagaaactggccaaagaaggt
agctcagataacaagctggcgacgccagtaggcggccaaagcgagggcgacggaacaccg
gacgtgaagatgtcagacgacgaaggtagcactgggagggaagggaccggtagcctcaaa
cggaagagagacgaactcagtgtcggtaacacgaacactcctgacgatacaccgacttct
tcaacaaaacgacagcgatcgtcaacaccaccaccaccacctccccctgccatgaatacc
aacgacaataacaacgacaatgacgatatgagcgtgagaagcgatgaacctgatgccgac
gcagacgcagacgaggttgtcttagtcggtaacccaacacctcctcctccgccgcctcca
cctccacaagaggacatgcgtatcccagacgcagatgcagagactaatggacacaatttc
gaaggatacggcgaaatgaatcgatcccatcaggctcagatcggcatcgagggaaatgta
tag

DBGET integrated database retrieval system