KEGG   Anaeromyxobacter sp. K: AnaeK_0832Help
Entry
AnaeK_0832        CDS       T00748                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
ank  Anaeromyxobacter sp. K
Pathway
ank03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ank00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    AnaeK_0832
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ank03400]
    AnaeK_0832
Enzymes [BR:ank01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AnaeK_0832
DNA repair and recombination proteins [BR:ank03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AnaeK_0832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_C DNA_ligase_A_M RNA_ligase DNA_primase_S DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: ACG72068
UniProt: B4UEC1
LinkDB All DBs
Position
complement(943122..945176)
Genome map
AA seq 684 aa AA seqDB search
MPARPAGARRGRRLPRHAGGGELSRVARAPVPTYRAQLATLVAAPPAGGGWVHETKYDGY
RIGCALEGGRATLWSRRGNDWTAQFPEVARAAEALPARSALLDGEVAAVLPGGRTSFQAL
QQAFSGGRRSLAYFVFDLLWLDGEDLSGRPLRERKDALRRLLGARGAVLRYAPHVEAPGA
EVLREACRLGLEGIVSKRADAPYRPGRNTTWTKAKCLARQELVIGGFTDPEGSRQGIGAL
LVGFHEGGALRFAGKVGTGFTQASARALRARLDRLERADPPFTPRPPGALGRIAHWVRPE
LVAEVAFTEWTDDGKVRHPSFQGLREDKRAADVVREVPGAGAPPAPPAPPAPAPAPTAAG
RARRRAAAGAAGEVVIGGVRLSHPERTMFPGEGRAALTKADVARYYDAVAGAMVPHLRGR
PLTLFHCPEGITGACRFMKHSKTWAPPAVRRIRIQEKTKVGEYLIADDRAALLALVQMDV
LELHTWNSTVEALEQPDRIVLDLDPGPEVPWREVVRAARLLRSALEALGLAAFVKTTGGA
GLHVVTPLVPRRRWEDCLAFARGLAATVARHEPRAFTVAFARAGRERRILLDYLRNNRTN
TSVAAFSLRARPGAPASVPVAWDELGPRLRPERLDARTVPRRLARLGADPWAGWARAARP
LGDAHLAAVGAAPVDEPARGGGRR
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgccggcccgccccgccggcgcccgccgggggcgccgcttgccccgccacgccgggggt
ggtgagctttcccgcgtggcccgcgcgcccgtcccgacctaccgcgcccagctcgcgacg
ctcgtcgcggcgccgccggcgggcggcggctgggtccacgagacgaagtacgacggctac
cggatcggctgcgcgctggagggcgggcgcgccacgctctggagccggcgcggcaacgac
tggaccgcgcagttccccgaggtggcgcgggcggccgaggcgctgccggcgcggagcgcg
ctcctcgacggcgaggtggcggcggtgctgcccggcggccggaccagcttccaggcgctc
cagcaggcgttctccggcggccgccgctcgctcgcctacttcgtgttcgatctgctctgg
ctggacggcgaggacctgtccgggcggccgctgcgcgagcgcaaggacgccctgcgccgg
ctcctcggcgcgcgcggcgccgtgctccggtacgcgccgcacgtggaggcgcccggcgcc
gaggtgctccgcgaggcgtgccgcctcggcctggaggggatcgtctcgaagcgcgccgac
gcgccctaccggcccgggcggaacaccacctggacgaaggcgaagtgcctcgcgcgccag
gagctggtgatcggcgggttcaccgatcccgagggcagccgccagggcatcggggcgctg
ctggtgggcttccacgagggcggcgcgctgcgcttcgccgggaaggtcggcaccggcttc
acccaggcgtcggcgcgggcgctgcgcgcgcgcctcgaccgcctggagcgcgccgacccg
ccgttcacgccgcggccgcccggcgcgctcgggcggatcgcgcactgggtgcggccggag
ctggtggccgaggtggcgttcaccgagtggaccgacgacgggaaggtgcgccacccgtcg
ttccaggggctgcgcgaggacaagcgcgccgcggacgtggtgcgcgaggtccccggcgcc
ggcgcgccaccggcgccgccggccccaccggcgcctgcgcccgcgccgaccgccgcgggt
cgcgcccggcgccgcgcggcggcgggcgccgccggcgaggtggtgataggcggcgtccgg
ctctcgcacccggagcgcaccatgttcccgggcgaggggcgggccgcgctcacgaaggcc
gacgtggcccggtactacgacgcggtggccggcgcgatggtgccgcacctgcgcggccgc
ccgctcaccctgttccactgcccggagggcatcaccggcgcgtgccgcttcatgaagcac
tcgaagacctgggcgccgcccgccgtgcgtcggatccgcatccaggagaagaccaaggtg
ggcgagtacctgatcgccgacgatcgcgccgcgctgctcgcgctcgtgcagatggacgtc
ctcgagctgcacacctggaactcgacggtggaggcgctggagcagccggaccggatcgtg
ctcgacctcgacccgggaccggaggtcccgtggcgcgaggtggtgcgcgcggcgcggctg
ctgcgctcggcgctggaggcgctgggcctcgccgcgttcgtgaagaccaccggcggcgcg
gggctgcacgtggtgacgccgctggtgccgcggcggcgctgggaggactgcctcgcgttc
gcgcgcgggctcgccgccacggtggcgcgccacgagccgcgcgcgttcacggtggcgttc
gcgcgcgccgggcgcgagcggaggatcctcctcgactacctgcggaacaaccggaccaac
acctcggtggccgcgttctcgctgcgcgcgcggccgggcgcgcccgcctcggtgccggtg
gcctgggacgagctggggccgcggctgcgaccggagcgcctggacgcgcggaccgtcccg
cgacggctggcgcggctcggcgcggatccgtgggccggctgggcgcgcgccgcccggccg
ctcggcgacgcgcacctcgccgcggtgggcgccgcgccggtggacgagccggcgcggggc
ggggggcggcggtga

DBGET integrated database retrieval system