KEGG   Anaeromyxobacter sp. K: AnaeK_0926Help
Entry
AnaeK_0926        CDS       T00748                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ank  Anaeromyxobacter sp. K
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACG72161
UniProt: B4UF51
LinkDB All DBs
Position
complement(1056108..1056851)
Genome map
AA seq 247 aa AA seqDB search
MARRVSNTTTDHDTIRRWVEERGGWPASVSGTERGDETGIIRIDFPGYSGEGKLERISWD
DWFEKFDEADLAFTYEETTAGGQRSNFNKLIGRETAAARARGQRTSRRASRAGGARRGGA
RTGARARSRTAAGRAGARAARGGTGRTRKAARAGASRTSGGGRSGAQGSTRGRTGGRRTG
ETQGRRQASRAEAARTTTRRGGTSRSGTARGKSRSTSRGSSRGTSRGGSRSGGSRRGRAR
GRGRGQA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgacgggtttcgaacacgacgacggatcacgacacgatccgcaggtgggtggag
gagcgcggcggctggccggcgtccgtcagcggcaccgagcggggcgacgagaccggcatc
atccgcatcgacttccccggctacagcggcgaggggaagctggagcggatctcctgggac
gactggttcgagaagttcgacgaggcggacctcgcgttcacctacgaggagaccaccgcc
ggcgggcagcgctcgaacttcaacaagctcatcgggcgcgagacggcggcggcacgggcg
cgcgggcagcggacgtcgcgccgcgccagccgcgccggcggcgcgcgccgcggcggcgcc
cggacgggcgcgcgggcgcggagccgcacggcggcggggcgggccggggcgcgggcagcg
cgcgggggcaccggacgcacgcggaaggcggcgcgcgcgggcgcgtcgcggacgtcgggt
ggcgggcggagcggcgcgcagggcagcacgcgcggccggacgggcgggcgccgcacgggc
gagacgcaggggcgccgccaggcctcccgcgcggaggcggcccgcaccaccacgcggcgc
ggcggcacgtcgcgctcgggcaccgcccgcggcaagtcgcggagcacgtcgcgcggcagc
tcgcgcgggacctcgcgcggcgggtctcggtccgggggctcgcgccggggccgcgcgcgc
ggccgcggccgcggtcaggcgtag

DBGET integrated database retrieval system