KEGG   Anaeromyxobacter sp. K: AnaeK_4319Help
Entry
AnaeK_4319        CDS       T00748                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
ank  Anaeromyxobacter sp. K
Pathway
ank00970  Aminoacyl-tRNA biosynthesis
ank01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ank00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AnaeK_4319
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ank03029]
    AnaeK_4319
Enzymes [BR:ank01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AnaeK_4319
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AnaeK_4319
Mitochondrial biogenesis [BR:ank03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AnaeK_4319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ACG75522
UniProt: B4UIV0
LinkDB All DBs
Position
complement(4858261..4859715)
Genome map
AA seq 484 aa AA seqDB search
MPISDFQVVIGLEVHAQLLTASKIFCGCSTAFGAAPNAHTCPVCLGLPGALPALNRSVVE
MAVRTGLALGCEIRPKSVFARKNYFYPDLPKGYQISQYELPICEGGEVTFTLDGRDHTAR
LVRIHMEEDAGKNVHDVAADGASGVDLNRAGVPLVEIVSRPDLRSAEEAVEYLKALRAIL
MALGVNDGNMQEGSLRCDANVSVMRKGASELGTRCEIKNMNSFRFLKQAIEFEARRQVEL
IEAGEPVVQETRLFDPDRGETRSMRSKEEAHDYRYFPEPDLPPVIVEAALVERIRGELPE
LPRARAERYQRSLGLSAYDAGNLVADAAVSAWFDAALAAYGAGPEAAKKVANWVTGELAR
LANETGEAPAAWKVTPARLAATLRLVDAGTIGGPGAKQVLEEVFRTGAEPDAVVKAKGLA
QVSDEGAIEAAVDKVLAANPGEAEKYRGGRKNLLGFFVGQVMKEMRGKGNPAVVNALLRR
KLGD
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgccgatctccgacttccaggtggtgatcgggctcgaggtccacgcgcagctcctcacc
gccagcaagatcttctgcggctgctccaccgcgttcggcgccgcgcccaacgcgcacacc
tgcccggtgtgcctgggcctccccggcgcgctcccggcgctgaaccgctcggtggtggag
atggcggtgcgcaccgggctcgcgctcggctgcgagatccgcccgaagagcgtgttcgcg
cggaagaactacttctacccggacctcccgaagggctaccagatctcgcagtacgagctg
cccatctgcgagggcggcgaggtgacgttcacgctcgacggccgcgaccacaccgcgcgg
ctggtccggatccacatggaggaggacgccggcaagaacgtgcacgacgtcgccgccgac
ggcgcctccggcgtggacctgaaccgcgccggcgtgccgctcgtcgagatcgtctcgcgc
ccggacctgcgctccgccgaggaggcggtcgagtacctgaaggcgctgcgcgcgatcctg
atggcgctcggggtgaacgacgggaacatgcaggaggggtcgctccgctgcgacgcgaac
gtgtcggtgatgcgcaagggcgcctccgagctcggcacgcgctgcgagatcaagaacatg
aactcgttccgcttcctgaagcaggcgatcgagttcgaggcgcgccgccaggtggagctg
atcgaggcgggcgagccggtggtgcaggagacgcggctgttcgacccggaccgcggcgag
acccgctcgatgcgctcgaaggaggaggcgcacgactaccgctacttcccggagccggac
ctgccgccggtgatcgtcgaggcggcgctggtggagcggatccgcggcgagctgccggag
ctgccgcgcgcccgggccgagcgctaccagcgcagcctggggctctccgcctacgacgcc
ggcaacctggtggcggacgcggcggtgtcggcctggttcgacgcggcgctcgcggcgtac
ggcgccggtccggaggcggcgaagaaggtcgcgaactgggtgaccggcgagctggcgcgg
ctggcgaacgagaccggcgaggcgcccgccgcctggaaggtcacgcccgcgcggctcgcg
gccacgctgcgcctcgtcgacgccggcaccatcggcggcccgggcgcgaagcaggtgctg
gaagaggtcttccgcaccggcgccgagcccgacgcggtggtgaaggcgaaggggctcgcg
caggtgtccgacgagggcgccatcgaggccgcggtggacaaggtgctcgccgcgaacccg
ggcgaggcggagaagtaccgcggcggccgcaagaacctcctcggcttcttcgtcgggcag
gtcatgaaggagatgcgcggcaagggcaacccggcggtggtgaacgcgctgctgcgcagg
aagctgggggactga

DBGET integrated database retrieval system