KEGG   Anoxybacillus sp. B7M1: GFC29_1864Help
Entry
GFC29_1864        CDS       T04426                                 

Gene name
yajC
Definition
(GenBank) preprotein translocase, YajC subunit
  KO
K03210  preprotein translocase subunit YajC
Organism
anl  Anoxybacillus sp. B7M1
Pathway
anl02024  Quorum sensing
anl03060  Protein export
anl03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:anl00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    GFC29_1864 (yajC)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    GFC29_1864 (yajC)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    GFC29_1864 (yajC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:anl02044]
    GFC29_1864 (yajC)
Secretion system [BR:anl02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   GFC29_1864 (yajC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YajC Orf78 Chordopox_G3
Motif
Other DBs
NCBI-ProteinID: ANB64292
UniProt: A0A160FC75
LinkDB All DBs
Position
complement(1878306..1878575)
Genome map
AA seq 89 aa AA seqDB search
MATLVNLLPLLIMFAIFYFLLIRPQQKRQRAVQQMQANLKKGDKIITIGGLHGIIDSIDE
NKVVIRAGDGSRLTYDRSAIREVVAENNQ
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgcttgtgaatcttttgccgcttctgatcatgttcgcgattttctatttcctg
ctgattcgtccgcagcaaaaacggcagcgggctgttcagcaaatgcaagcgaacttgaaa
aaaggcgataaaattattacgatcggcggtttgcatggcatcatcgattccatcgatgag
aataaagtcgtgatccgcgcgggagacggttctcgtcttacatacgatcgctctgctatt
cgcgaggttgtggcagagaacaaccaatag

DBGET integrated database retrieval system