KEGG   Anoxybacillus sp. B7M1: GFC29_1865Help
Entry
GFC29_1865        CDS       T04426                                 

Gene name
tgt
Definition
(GenBank) tRNA-guanine transglycosylase
  KO
K00773  queuine tRNA-ribosyltransferase [EC:2.4.2.29]
Organism
anl  Anoxybacillus sp. B7M1
Brite
KEGG Orthology (KO) [BR:anl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:anl03016]
    GFC29_1865 (tgt)
Enzymes [BR:anl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.29  tRNA-guanosine34 transglycosylase
     GFC29_1865 (tgt)
Transfer RNA biogenesis [BR:anl03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    GFC29_1865 (tgt)
 Prokaryotic Type
    GFC29_1865 (tgt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TGT
Motif
Other DBs
NCBI-ProteinID: ANB63966
UniProt: A0A160FAK2
LinkDB All DBs
Position
complement(1878591..1879730)
Genome map
AA seq 379 aa AA seqDB search
MTPIRYELIKTCKQTGARLGIIHTPHGSFETPMFMPVGTLATVKTLSPEELKEMGAGIIL
SNTYHLWLRPGHDIVKEAGGLHSFMNWDRGILTDSGGFQVFSLSEFRKIEEGGVYFRNHL
NGDKLFLSPEKAMEIQNALGSDIMMAFDECPPYPATYEYMKKSVERTSRWAERCLKAHAR
PNEQGLFGIVQGGEFEDLRRQSAQDLVSLDFPGYAVGGLSVGEPKDVMNRVLEFTTPLLP
ANKPRYLMGVGSPDSLIDGAIRGIDMFDCVLPTRIGRNGTVMTSEGRLVIKNAQYARDFT
PLDPNCGCYTCRNYTRAYIRHLIKCDETFGIRLTSYHNVYFLIKLMEQVRQAIREDRLGD
FREEFFERYGFNRPNAKNF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
ttgaccccgattcgttatgaacttatcaaaacatgcaagcaaacaggagcacgtctcgga
atcattcatacgccgcatggctcctttgaaacgccgatgtttatgccagtcggcacatta
gcgactgtcaaaacgttatcgcctgaggaattaaaagaaatgggtgcaggcattatttta
agcaacacctatcatctatggcttcgtccagggcatgatattgtgaaagaagcgggcgga
ttgcattcgtttatgaactgggatcgcggcattttgactgattctggcggctttcaagtc
ttcagcctgagtgaatttcgcaaaattgaagagggaggcgtatattttcgcaatcattta
aatggagacaagctgtttctttcgccggaaaaagcgatggaaatccaaaatgcgctcggc
tctgatatcatgatggcgtttgatgaatgcccgccgtatcctgcgacatatgaatatatg
aaaaaatcggttgagcggacaagccgctgggcggaacgctgtttaaaagcgcatgcccgt
ccaaatgaacaggggctgtttggcattgttcaaggcggtgaatttgaggacttacgcaga
cagagcgcgcaggatcttgtgtctctcgattttccgggctatgcggtcggcggtttgtcg
gtaggagaaccgaaagatgtcatgaatcgcgtgcttgagtttacaacgccgcttttacca
gccaataaacctcgctatttaatgggagttggttcgccggactcgctcattgacggcgcc
atccgcggaattgacatgtttgattgcgtcttgccgactcgcattggacgaaatggaacg
gtgatgacaagcgaagggcgccttgtcatcaaaaatgcgcaatacgcccgtgattttacg
ccgctggatccgaactgcggctgctatacatgccgcaactatacgcgcgcctatattcgt
catcttatcaaatgtgatgaaacgtttggtattcgcttgacttcttatcataacgtttac
tttttgataaaattaatggagcaagtgagacaagcgatacgtgaagatcggcttggcgat
tttcgcgaagaattttttgaacgctacggatttaatagaccgaatgcgaaaaacttttag

DBGET integrated database retrieval system