KEGG   Anoxybacillus sp. B7M1: GFC29_1870Help
Entry
GFC29_1870        CDS       T04426                                 

Definition
(GenBank) hypothetical protein
  KO
K06318  forespore regulator of the sigma-K checkpoint
Organism
anl  Anoxybacillus sp. B7M1
Brite
KEGG Orthology (KO) [BR:anl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    GFC29_1870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BofC_C BOFC_N DUF3396 Bacteroid_pep PhrC_PhrF
Motif
Other DBs
NCBI-ProteinID: ANB64543
UniProt: A0A160FDG6
LinkDB All DBs
Position
complement(1882734..1883216)
Genome map
AA seq 160 aa AA seqDB search
MKLLMACLAIAISFISSSAAFAKAPATQMTILLERIYVDGEVSEEIKQETITSMKDIWKK
YEGWQLVNLDDEQIVFQKMVQDISPLSKANGYFGLTKDGTLSIFEGKPGKSSRVIQSFFQ
LDIKKLESHQQERLKKGIRVISKDRYKEVIEAYRPFAVTQ
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttttgatggcttgcttggctatcgcgatttcatttataagttcctcagctgcc
ttcgctaaagcgccggccactcaaatgacgattttgttagaacgaatatacgtggacgga
gaagtgagtgaagaaattaaacaagaaacgattacatcgatgaaggatatatggaaaaag
tatgaaggctggcagcttgtcaatcttgatgatgaacaaattgtgttccagaaaatggtt
caagatatttcacctttgtcaaaagcgaatggatattttggcttaacaaaggatggaact
ttatctatttttgaaggcaagccaggaaaatcatcacgcgtgattcaatcgtttttccag
ctcgatataaaaaagctagaaagccatcaacaagaacggctgaaaaaaggtattcgcgtg
atttcgaaagatcgttataaagaggtcattgaagcctatcggccatttgccgttactcag
taa

DBGET integrated database retrieval system