KEGG   Anoxybacillus sp. B7M1: GFC29_1959Help
Entry
GFC29_1959        CDS       T04426                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur family protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
anl  Anoxybacillus sp. B7M1
Pathway
anl00020  Citrate cycle (TCA cycle)
anl00190  Oxidative phosphorylation
anl00650  Butanoate metabolism
anl01100  Metabolic pathways
anl01110  Biosynthesis of secondary metabolites
anl01120  Microbial metabolism in diverse environments
anl01130  Biosynthesis of antibiotics
anl01200  Carbon metabolism
Module
anl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
anl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:anl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GFC29_1959
   00650 Butanoate metabolism
    GFC29_1959
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    GFC29_1959
Enzymes [BR:anl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     GFC29_1959
    1.3.5.4  fumarate reductase (quinol)
     GFC29_1959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_10 Fer4_9 Fer4_17 Fer4_2 Fer4_16 Fer4_18 Fer4 Fer4_4 Fer4_13 Fer4_21 Fer4_3 Fer4_15
Motif
Other DBs
NCBI-ProteinID: ANB63929
UniProt: A0A160FAM1
LinkDB All DBs
Position
complement(1984516..1985277)
Genome map
AA seq 253 aa AA seqDB search
MSEKKTIRLIVTRQDRPDSAPYEEEFEIPYRPNMNVISALMEIRRNPVNAKGEKTTPVTW
DMNCLEEVCGACSMVINGKPRQSCTALIDKLEQPIRLEPMRTFPVVRDLQVDRSRMFDSL
KKVKAWIPIDGTYDLGPGPRMPERKRQWAYELSKCMTCGVCLEACPNVNSKSNFIGPAPL
SQVRLFNAHPTGAMHKEERLKAIMGDGGLANCGNSQNCVQSCPKGIPLTTSIAALNRATT
VQAFRSFFGSDEV
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaaaaaaacgattcgtctcattgtaacgcgacaagatcgtccggattctgcg
ccatacgaagaggaatttgagattccatatcgtcccaatatgaacgttatttccgctctc
atggaaattcgccgcaatccggtaaatgctaagggagaaaaaacaactccagtcacatgg
gatatgaactgtttagaagaagtgtgcggagcttgctccatggtcattaacggaaagccg
cgccaatcctgtacagctcttatcgataagctggagcagccaatccgtttagaaccgatg
cgtacattcccggttgtgcgcgacttgcaagtcgatcgcagccggatgtttgattccttg
aaaaaggtaaaagcatggattccgattgatggaacctatgatttaggtccgggcccgcgc
atgccagaacgaaaacgtcaatgggcatatgagctttctaaatgcatgacttgcggcgtg
tgcttggaagcttgcccgaatgtgaacagcaaatcaaactttatcggtcctgcaccgctt
tcacaagtgcgtttatttaacgctcatccaactggtgccatgcataaagaggaacgtctt
aaagccattatgggggatggagggctagcgaactgcggtaactcgcaaaactgcgtgcag
tcttgcccgaaaggcattccgctcactacctccattgcagcgttaaaccgcgctacaact
gttcaagcgtttcgcagctttttcggaagcgacgaagtgtaa

DBGET integrated database retrieval system