KEGG   Anoxybacillus sp. B7M1: GFC29_1960Help
Entry
GFC29_1960        CDS       T04426                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase/fumarate reductase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
anl  Anoxybacillus sp. B7M1
Pathway
anl00020  Citrate cycle (TCA cycle)
anl00190  Oxidative phosphorylation
anl00650  Butanoate metabolism
anl01100  Metabolic pathways
anl01110  Biosynthesis of secondary metabolites
anl01120  Microbial metabolism in diverse environments
anl01130  Biosynthesis of antibiotics
anl01200  Carbon metabolism
Module
anl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
anl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:anl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GFC29_1960 (sdhA)
   00650 Butanoate metabolism
    GFC29_1960 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    GFC29_1960 (sdhA)
Enzymes [BR:anl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     GFC29_1960 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     GFC29_1960 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 HI0933_like NAD_binding_8 FAD_binding_3 FAD_oxidored AlaDh_PNT_C DAO
Motif
Other DBs
NCBI-ProteinID: ANB64935
UniProt: A0A160FE85
LinkDB All DBs
Position
complement(1985274..1987034)
Genome map
AA seq 586 aa AA seqDB search
MKKGKIIVVGGGLAGLMATIKIAEAGVPVELFSLVPVKRSHSVCAQGGINGAVNTKGEGD
SPWEHFDDTVYGGDFLANQPPVKAMCEAAPGIIYLLDRMGVMFNRTPEGLLDFRRFGGTQ
HHRTAFAGATTGQQLLYALDEQVRRHEVAGLVTKYEGWEFLGAVLDDEQICRGIVAQNLT
TMEIQSFAADAVIMATGGPGIIFGKSTNSIINTGSAASIVYQQGAYYANGEFIQIHPTAI
PGDDKLRLMSESARGEGGRVWTYKDGKPWYFLEEKYPAYGNLVPRDIATREIFHVCVDLK
LGINGENMVYLDLSHKDPKELDIKLGGIIEIYEKFMGEDPRKVPMKIFPAVHYSMGGLWV
DYDQMTNIKGLFAAGECDYSMHGANRLGANSLLSAIYGGMVAGPKAVEYIKGLDKSSDAL
PSSLYERYVKQEEERWNNILSMNGTENAYVLHKELGEWMTDNVTIVRYNDKLLRTDEKIQ
ELMERYKNINISDTAKWSNQAASFTRQLHNMLQLARVITLGAYNRNESRGAHYKPEFPER
NDEEWLKTTMARFTPDGPAFHYEDVDTSLIKPRKRDYSKKKEDVKS
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggaaaaatcatagtagttggcggcggtttagccggactaatggccaccatt
aaaatcgcagaagcgggtgtgccagtggaattgttttcgcttgtgccagtaaagcggtct
cactctgtttgtgctcaaggtgggattaacggtgcggtgaatacaaagggtgaaggagat
tctccgtgggaacatttcgacgatacggtatatggtggtgactttttggcaaaccaacca
ccagtcaaagcaatgtgtgaagcagcaccaggcattatttatttattagatcgtatgggt
gttatgtttaaccgtacacctgagggattgctagatttccggcgctttggtggaacgcag
catcaccgtactgcatttgcgggggcaacaacgggtcagcagctgctttatgcgcttgat
gagcaagtgcgccgccatgaagtcgctggcttggttacgaagtatgaaggctgggagttc
cttggtgcggtactagatgatgagcaaatttgccgtgggattgttgcgcaaaacttaacg
accatggaaatccaatcatttgctgctgatgctgtgattatggcaacgggtggcccaggc
atcattttcggaaaatccaccaactcgattattaatacaggttcagctgcatcgattgtt
taccagcaaggtgcctattatgcgaatggagaatttattcaaatccatccaacggcgatc
ccgggtgatgataaattacggcttatgagtgaatcggcgcgcggtgaaggcggtcgagtc
tggacatataaagatggtaaaccatggtatttcttagaggaaaaatatccagcatacgga
aatctagttccgcgtgatattgcgactcgtgaaatattccatgtttgtgttgatttgaag
cttggcatcaacggcgaaaatatggtgtacctcgatctttctcataaagatcctaaggaa
ctcgatattaaattaggtggcattattgagatttatgagaaattcatgggagaagatccg
cgtaaggtgccgatgaaaatcttcccagctgtgcactactccatggggggattatgggtt
gactatgatcaaatgacgaatattaaaggattgtttgctgctggagagtgcgactattct
atgcatggcgccaaccgcttgggagctaactcgctcttatcggcgatttatggcggaatg
gttgcaggtccgaaggccgttgaatatattaagggattggacaagtcatctgatgcgctt
ccttcttctttatatgagcgttatgtaaaacaagaagaagaacgttggaacaatatttta
tcgatgaatggaacagaaaatgcttatgtgcttcataaagagcttggcgaatggatgacc
gataatgtgacgattgttcggtataacgataaacttttaagaacggatgaaaaaattcaa
gagctgatggagcgttataaaaatattaatattagcgatacagctaaatggagtaatcag
gcagcttcatttactcgccagcttcataacatgcttcaattagcgcgtgtgattacactt
ggtgcatacaatcgaaacgaaagccgcggcgctcattacaaaccggagtttccagagcgc
aatgatgaagagtggctaaaaacaacaatggctcgctttactccagatggtccagcgttc
cattatgaagatgtggatacatcactaattaagcctcgtaaacgtgactattcgaaaaag
aaagaggatgtgaaatcatga

DBGET integrated database retrieval system