KEGG   Anoxybacillus sp. B7M1: GFC29_2017Help
Entry
GFC29_2017        CDS       T04426                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
anl  Anoxybacillus sp. B7M1
Pathway
anl00020  Citrate cycle (TCA cycle)
anl00480  Glutathione metabolism
anl01100  Metabolic pathways
anl01110  Biosynthesis of secondary metabolites
anl01120  Microbial metabolism in diverse environments
anl01130  Biosynthesis of antibiotics
anl01200  Carbon metabolism
anl01210  2-Oxocarboxylic acid metabolism
anl01230  Biosynthesis of amino acids
Module
anl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
anl_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:anl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GFC29_2017 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    GFC29_2017 (icd)
Enzymes [BR:anl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     GFC29_2017 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ANB65967
UniProt: A0A167USL1
LinkDB All DBs
Position
complement(2048911..2050185)
Genome map
AA seq 424 aa AA seqDB search
MVQGEKITVTNGVLNVPNNPIIPFIEGDGTGPDIWAAASRVLEAAVEKAYKGEKKIAWKE
VLAGEKAYKLTGEWLPQETLDVIREYIIAIKGPLTTPVGGGIRSLNVALRQELDLFVCLR
PVRYFNGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGTEEVKKVIHFLQNEMGVRKIR
FPETSGIGIKPISEEGTKRLVRAAINYAIEHGRKSVTLVHKGNIMKFTEGAFKNWGYELA
EQEFGDKVFTWAEYDRIVEAEGKEAANKAQAEAEAAGKIIVKDAIADIFLQQILTRPREF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVMMFEHLGWNEAAKLIIESMEKTIASKVVTYDFARLMEGATEVKCSEFADALIR
NMGE
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
gtggttcaaggtgaaaaaattacagtcacaaacggtgtgttaaacgtaccaaacaatccg
attatccctttcattgaaggtgatgggacaggccctgatatttgggcggcagcctcccgc
gtgctagaagctgcggttgaaaaagcctataaaggagaaaagaaaattgcttggaaagaa
gttcttgctggcgaaaaagcatataagctaacgggagaatggctgcctcaagaaacgttg
gatgtgattcgcgaatacataattgccattaaaggcccattaacgacccctgtcggcgga
gggattcgttcattgaatgtcgcgcttcgtcaagagcttgatttgtttgtttgcttgcgc
ccagtccgttacttcaatggcgtgccttctccagtgaaacgtcctgaagatacggatatg
gttattttccgtgaaaatacagaagatatttatgccggaattgagtatgccaaaggcact
gaagaagtgaaaaaagtgattcactttttgcaaaatgaaatgggcgttcgtaaaattcgc
ttcccggaaacatctggtatcggtattaagccgatttccgaggagggaactaaacgtctc
gttcgagcagccatcaactatgctatcgagcacggccgcaagtctgttacgctcgtacat
aaaggaaacattatgaaatttacggaaggcgcatttaaaaactggggctatgagcttgca
gagcaagaatttggagataaagtctttacatgggcggaatatgatcgcatcgttgaagcg
gaaggaaaagaggctgcaaataaagctcaggctgaagcggaagcagcaggaaaaattatc
gttaaagatgcgattgctgatattttcttgcaacaaattttaacgcgtccacgtgagttt
gatgttgtcgcgactatgaatttgaacggtgactatatttcagatgccttggcagctcaa
gtaggaggtattggcattgctccaggtgcaaatattaactatgaaacagggcatgccatc
tttgaagcgactcatggcacggctccaaaatatgcaggattagacaaagtaaatccatcc
tctgttattttgtcaggcgtcatgatgtttgagcaccttggctggaatgaagcggctaag
ctgattattgaatccatggagaaaacaattgcttcgaaagtcgtcacctacgatttcgcc
cgtctgatggaaggagcaacagaagtgaagtgctctgagtttgctgatgcattgatccgt
aatatgggagaataa

DBGET integrated database retrieval system