KEGG   Anoxybacillus sp. B7M1: GFC29_2291Help
Entry
GFC29_2291        CDS       T04426                                 

Definition
(GenBank) glycosyl transferases group 1 family protein
Organism
anl  Anoxybacillus sp. B7M1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_4 Glyco_trans_1_4 Glyco_trans_1_2 Glycos_transf_1
Motif
Other DBs
NCBI-ProteinID: ANB65669
UniProt: A0A160FEJ4
LinkDB All DBs
Position
complement(2321051..2322070)
Genome map
AA seq 339 aa AA seqDB search
MNMIIFPPTIDWSWMRQRPQQLAKQLAKRGYTVFYCNQSTQKKPVEEMMPRLYIVHHFSK
WVREEYPRLKQTYGNVVGLWCTWPKLTPYIKKMKPDWVIYDCVDEMERWQRYEPEMVKRS
NAIICTSQPLFERLRKDYPFKRIEIVRNGYDPDLSLHLEHASSILPRDLPKNNRPLVGYV
GAWAPWIDEELVRRLLREKIDLVVIGTEFGLNYCSYGKSNMHFLGHKTHEQLANYLPFFH
VCIIPFQKNKLTAAVNPVKAYEYLAAGKPVVSTNLPECRQMYPYVEIGHSHDEFVSKVLH
YIHHAGDASDRIRYALQHTWDHRGEQIEAIIKEFTHFKR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgattatttttcccccgacgattgattggtcatggatgaggcaacggccgcaa
caattggccaagcagctggctaaaagaggatataccgttttttattgcaatcaatcaacg
caaaaaaagcctgtagaagaaatgatgccaagattatatattgttcatcattttagtaaa
tgggtaagagaagagtatccaagactgaaacagacgtatggaaatgtggttggcctatgg
tgtacgtggccgaaattaacaccttatataaaaaaaatgaaaccggattgggtgatctat
gattgcgtagatgaaatggaaagatggcagcgttacgagccggaaatggtaaagcgatca
aatgccattatttgcacgtcacagcctctgtttgagcggctgcgaaaggactatcccttc
aagcgtattgagattgtacgaaatggctacgatcccgatttatcacttcatctagaacat
gcatcgtccatccttccacgtgatttaccaaaaaataatagaccgctagtaggttatgtg
ggggcatgggcaccgtggattgacgaagagcttgtgcggcgactgctgcgggagaaaatt
gatttggtcgtcattggaaccgaatttggtttgaattattgttcatatgggaaatcgaac
atgcattttctagggcataaaacgcatgagcagcttgcgaactatcttcctttttttcat
gtttgtatcatccctttccaaaagaataaacttacagccgctgttaatcctgtcaaagca
tatgaatatttagcggctggaaagcccgtcgtttcaaccaatctccccgaatgcagacag
atgtatccctatgtagagatcggacattctcatgatgagtttgtttccaaggtacttcac
tatatccatcatgcaggagatgcgtctgaccgcatccgctatgctttacagcacacttgg
gatcaccgcggtgagcaaatcgaagcgattattaaagaatttacacatttcaagagataa

DBGET integrated database retrieval system