KEGG   Anoxybacillus sp. B7M1: GFC29_2426Help
Entry
GFC29_2426        CDS       T04426                                 

Definition
(GenBank) hypothetical protein
  KO
K02406  flagellin
Organism
anl  Anoxybacillus sp. B7M1
Pathway
anl02020  Two-component system
anl02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:anl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GFC29_2426
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    GFC29_2426
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:anl02035]
    GFC29_2426
Bacterial motility proteins [BR:anl02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    GFC29_2426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flagellin_N Flagellin_C DUF1664 Rh5 DUF4795 Pup DUF4140 HlyD_2 HAUS-augmin3
Motif
Other DBs
NCBI-ProteinID: ANB64939
UniProt: A0A160FCW7
LinkDB All DBs
Position
complement(2455517..2456329)
Genome map
AA seq 270 aa AA seqDB search
MRIQHNISALNTHRQLAFNNTQAAKNLEKLSSGFRINRAGDDAAGLAISEKMRGQIRGLE
MASKNAQDSISLIQTAEGALTETHAILQRMRELAVQASNDTNVTADREAIQSEIDQLVSE
LDRIAGNTEFNTQKLLNGSFSGKVFQIGANSGQTITLSISNMDSSSLSVNSLSVSTASGA
QDAITKINTAIETVSKERSKLGAVQNRLEHTINNLGATSENLTAAESRIRDVDMAKEMME
FTKNNILMQAAQSMLAQSNQMPQGVLQLLR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgagaattcaacacaacatctctgcgttaaacacgcaccgtcaattagcgttcaacaac
actcaagctgcgaaaaaccttgagaagctttcttctggcttccgcattaaccgtgctggc
gacgatgcagcaggtcttgccatctctgaaaaaatgcgcggccaaatccgcggtttagaa
atggcatctaaaaacgcgcaagactctatttctttaattcaaacagcggaaggtgcgtta
acggaaactcatgctatccttcaacgtatgcgcgagcttgctgtacaagcatctaacgac
acaaacgtaacggctgaccgtgaagcaattcaaagtgagattgatcaacttgtttctgaa
cttgatcgtatagctggtaatactgaatttaacacgcaaaaacttttaaatggatctttt
agcggaaaagtgttccaaattggtgcaaacagcggccaaactattactttatcaattagt
aatatggactcttcttctttaagtgtgaacagtctttcagtaagcacagcttcaggtgcg
caagatgcgatcactaaaattaacacagctattgaaactgtatcaaaagagcgttctaaa
cttggtgcggtgcaaaaccgtttagaacacacaattaacaaccttggcgccacttctgaa
aacttaacagctgctgaatcacgtatccgtgacgttgacatggcgaaagaaatgatggag
ttcacgaagaacaacatcttaatgcaagctgcgcaatcaatgttggctcaatccaaccaa
atgccgcaaggagtattgcagctattacggtaa

DBGET integrated database retrieval system