KEGG   Anoxybacillus sp. B7M1: GFC29_2431Help
Entry
GFC29_2431        CDS       T04426                                 

Gene name
flgK
Definition
(GenBank) flagellar hook-associated protein FlgK
  KO
K02396  flagellar hook-associated protein 1 FlgK
Organism
anl  Anoxybacillus sp. B7M1
Pathway
anl02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:anl00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    GFC29_2431 (flgK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:anl02035]
    GFC29_2431 (flgK)
Bacterial motility proteins [BR:anl02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    GFC29_2431 (flgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flg_bbr_C Flg_bb_rod Erp_C
Motif
Other DBs
NCBI-ProteinID: ANB62578
UniProt: A0A160F7M3
LinkDB All DBs
Position
complement(2458680..2460260)
Genome map
AA seq 526 aa AA seqDB search
MGSTFQGLEIAKRGMSTQQMALYVTGNNIANANTPGYSRQRVNFTETEPYPPASMNRPQI
PGQMGTGVEAGSIQRVREKFLDLQYRDEATKLGYWSTRSDAIAKMEDIMNEPSDFGLGKV
MSQFWQSLQDLSTNPENEGARAAVRQRGVAVAESFRYLSNSLSKIRTDLGQEIKTGLLEV
NSILKQISELNDQIKAIEPNGYLPNDLYDKRDALVDELSKFINVKVDTVPSGGNSLDIAE
GIYEISMVNGDGSLMKIVTQNGLSSFSVDPAVSGDPTNPDGYISHIQITDEQGNTSSLLP
DQIASGRMKALIEMYGYGTGPDNIKGYYPDMLADLDKMAYSFVTMFNSQHQAGFDLEGAA
GEDFFKTSIGSPPEKGAAATIEVSASIMANLSKIAASSKSGETGNGSNALYLAMIKDIQI
ASGSATLPSGDTISVPINGGTVQTFYQGLIGKLGVDGQQAKRMETNAETLVLSVENNRQS
VSSVSLDEEMTNMIKFQHAYNAAARQITVIDEMLDKIINGMGIVGR
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgggttcaacctttcaaggattggaaatcgccaaacgcggcatgtcgacgcagcaaatg
gcgttatacgtcacaggaaataatattgccaacgccaacacgccaggctattcgcgccaa
cgcgtcaattttaccgaaacggagccgtatccgccagcctcgatgaaccgcccgcaaatt
cctggacagatggggaccggggtcgaagccggctcgatccagcgcgtgcgggagaagttt
ttagatctgcagtacagagacgaggcaacgaaattgggatattggagcacccgttctgat
gccattgcgaagatggaagatattatgaacgagccaagtgattttgggctaggaaaagta
atgtcccagttttggcagtcattgcaggatttaagcacaaatcccgaaaatgagggcgct
cgtgctgctgttcgtcaaagaggagtagcggtggcagaatcttttcggtatctttcgaat
tccctttcgaaaatccgcacggatttaggacaagaaattaaaacaggattgcttgaagtg
aactccattttaaaacaaattagtgaattaaatgaccaaattaaagcaattgaaccaaac
ggttatttaccgaatgatctttatgacaaacgtgatgctcttgtggatgaattatcaaaa
ttcatcaatgtaaaggtggatacagttccttcaggtggcaattctcttgatattgctgaa
ggaatttatgaaatttctatggtgaatggtgatggatctttaatgaaaattgtcacacaa
aacggactttcctctttctcagtggatcctgctgtttcaggcgatcccaccaatcccgac
ggatatatttcacatatccaaattactgatgaacagggaaatacctcctctctcttgcct
gatcaaatagcatctggacgaatgaaggcgttaattgagatgtatggctatggcacaggc
cccgacaatataaaagggtactatccggatatgctggcggatttagataaaatggcttat
tcgtttgttactatgtttaattcacagcatcaagctgggtttgatttagagggagctgct
ggagaagatttctttaaaacgtcaatcggatctcctccagagaaaggggcagcggctact
attgaagtatctgctagcattatggcgaatttatcaaaaattgctgcttcttctaaatct
ggagaaaccggtaacggaagcaatgctctttacttagcaatgattaaggacatccaaatt
gcaagcggaagtgctacccttccaagcggagatacgattagtgttccgattaacggggga
accgtacaaacgttttatcaagggcttattggaaagcttggtgtagatggtcagcaagcg
aaacgcatggagaccaatgcggaaacgctagttttgtcggttgagaataatcggcagtcg
gtaagctcagtatctcttgatgaagaaatgacgaatatgattaagttccaacacgcttat
aatgcagcagcccggcaaatcacggtcattgatgagatgcttgataaaatcatcaacgga
atgggcattgtaggaaggtag

DBGET integrated database retrieval system