KEGG   Anoxybacillus sp. B7M1: GFC29_2434Help
Entry
GFC29_2434        CDS       T04426                                 

Definition
(GenBank) C4-type zinc-finger of DNA polymerase delta family protein
Organism
anl  Anoxybacillus sp. B7M1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-C4pol zf-ribbon_3 DZR zinc-ribbons_6 NMD3 zf-tcix zf-C2HC5 Latarcin AbiEi_4 TRAF6_Z2 RecR Auto_anti-p27 zf-C2HC_2 DUF2039 zf-FPG_IleRS Ribosomal_L36
Motif
Other DBs
NCBI-ProteinID: ANB62921
UniProt: A0A160F8X3
LinkDB All DBs
Position
complement(2461421..2461849)
Genome map
AA seq 142 aa AA seqDB search
MATVNLENCPNCGRLFVKNQFRDICDLCYREEEKEFTKVYNYMRKRENRMATLSEVVEAT
GVSERLIMKFIKSGRLQLANFPNLGYPCSRCGTIIREGKLCVSCKQDLSQQVEQLQKEET
KKEESSRPTTVYYTKKDDPKDF
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagtgaatctagaaaattgcccgaattgcggccgattatttgtcaaaaatcag
tttcgtgatatttgcgacctatgctatcgagaggaagaaaaagagtttacgaaggtgtat
aactatatgcgaaagcgggaaaaccgcatggcgacactgtcggaggtagtggaagcaacc
ggtgtgtccgagcgcctgattatgaaatttattaaatcgggacggctccagctcgccaac
tttccgaatttaggctacccttgcagccgctgcggcacgatcattcgcgaaggcaagctt
tgtgtttcgtgtaaacaagacctcagccagcaagtggagcagctgcaaaaagaagaaaca
aaaaaggaagagagcagccggccgacgaccgtatattatacaaaaaaagacgatccaaaa
gacttctaa

DBGET integrated database retrieval system