KEGG   Anoxybacillus sp. B7M1: GFC29_2485Help
Entry
GFC29_2485        CDS       T04426                                 

Definition
(GenBank) FAD dependent oxidoreductase family protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
anl  Anoxybacillus sp. B7M1
Pathway
anl00564  Glycerophospholipid metabolism
anl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:anl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    GFC29_2485
Enzymes [BR:anl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     GFC29_2485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 NAD_binding_8 DUF1048 Pyr_redox_2 Ribosomal_S24e GMC_oxred_N FAD_oxidored GIDA
Motif
Other DBs
NCBI-ProteinID: ANB62871
UniProt: A0A160F8T3
LinkDB All DBs
Position
complement(2520302..2521966)
Genome map
AA seq 554 aa AA seqDB search
MKKPVFAQQRQEILREVAGKTFDVIIIGGGITGAGIALDATTRGMSAVLFEMQDFAAGTS
SRSTKLVHGGLRYLKQLEVKLVAEVGKERAIVYENGPHVTSPEWMLLPIYKGGTFGKWST
SIGLRIYDYLADVKKSERRTMLTASQTMEKEPLLKREGLLGGGYYVEYRTDDARLTIEVM
KKAVECGAKALNYAKVNAFIYEKGKAVGVSVVDQITGESYQVFAKKIINATGPWVDTLRE
KDHSLKGKHLILSKGIHLVFDKSRFPLKQAIYFDTSDGRMVFAIPRDGKTYVGTTDTFYE
GDLAHPKMTVEDRDYLLRAIHDMFPTVGITAEDVESSWAGLRPLIHEVGKSPSEISRKDE
IWTADSGVITIAGGKLTGYRKMAETIVDRVAQLLKEEENASFSPCQTKKLPISGGDFGGS
AHMEAFVVKKAEQGEKAGLSRKQAERLARLYGTNVDRVFELAVQLKKEAAELQLPVDVLA
SLQYGLEEEMVVKPEDFFIRRTGALFFNIHFVRQWKESVIHYMAKTLEWSEAEQHRYQKE
LETYLHDAVTPVQI
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacctgtatttgcacagcaaagacaagaaattttaagagaggtcgcaggcaaa
accttcgatgtcatcattattggcggcggcattaccggcgcggggattgcgctcgatgca
acgacaagaggaatgagtgccgttttatttgagatgcaggattttgccgctggaacctcc
agtcgttccacgaagctggtgcatggagggctccgttatttaaagcagctggaggtgaag
ctcgtcgctgaagtggggaaagaacgcgcgattgtttatgaaaacgggccgcatgtgact
tcgcctgaatggatgctgctgccgatttataaaggaggaacctttggtaaatggagcacc
tcgattggactaagaatatacgattatctggcggatgtgaaaaaaagcgaacgaagaacg
atgttgacggcgtcgcaaacgatggagaaggaaccgctcttaaagcgagaaggattatta
ggcgggggatattatgtcgagtatcgaacagacgacgcacgcttgacgattgaagtgatg
aaaaaggcggtcgaatgcggcgccaaagcgctcaattatgccaaggtcaatgcgtttatt
tatgagaaggggaaagctgtaggggtaagcgtagtggatcaaatcaccggagagtcctat
caggttttcgcgaagaaaatcatcaacgccactggcccttgggtcgatactttgcgggaa
aaagatcacagcttgaaaggaaagcatctgattttgtcaaaaggcattcacttagtgttt
gacaaaagccgttttccattaaaacaagcgatctattttgatacatctgacggcagaatg
gtgtttgccattccgcgtgatggaaaaacatatgttggcacaacggatacgttttatgag
ggggatttggcccatccgaaaatgaccgtggaggatcgcgattatctccttcgggcgatt
catgatatgtttccaacggtcggcattaccgcggaagatgttgaatccagctgggctgga
ctcagaccgttgattcatgaggtagggaaaagcccgtcggaaatctcccgaaaagatgag
atttggacagcagattcaggtgtgatcacgatcgccggcggaaaattaacgggataccgc
aaaatggcggaaacgattgtggatcgggtcgctcaattgctaaaagaagaggaaaacgcc
agcttttccccttgccaaacgaaaaagctgcccatttccgggggcgatttcggaggctcc
gcccatatggaagcgtttgtagtcaaaaaagccgagcagggagaaaaggcgggactttcg
agaaaacaggccgaacgattggctcgcttatatggcacaaatgtagaccgggtgtttgaa
ttagccgttcaattaaagaaagaagcggccgagcttcaattgccggtcgatgtgttggct
tcccttcaatatggcctggaggaagagatggttgtcaaaccggaagacttctttattcga
agaacgggagcattatttttcaatattcatttcgttcgtcaatggaaggaatcggtgatt
cactatatggcgaaaaccttggaatggagtgaagcggaacaacaccggtatcaaaaagaa
ttagaaacatatttgcatgatgccgtcacacctgttcaaatatga

DBGET integrated database retrieval system