KEGG   Anoxybacillus sp. B7M1: GFC29_3034Help
Entry
GFC29_3034        CDS       T04426                                 

Definition
(GenBank) D-alanine--D-alanine ligase family protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
anl  Anoxybacillus sp. B7M1
Pathway
anl00473  D-Alanine metabolism
anl00550  Peptidoglycan biosynthesis
anl01100  Metabolic pathways
anl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:anl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    GFC29_3034
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    GFC29_3034
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    GFC29_3034
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:anl01011]
    GFC29_3034
Enzymes [BR:anl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     GFC29_3034
Peptidoglycan biosynthesis and degradation proteins [BR:anl01011]
 Precursor biosynthesis
  Amino acid ligase
   GFC29_3034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 ATPgrasp_ST GARS_A
Motif
Other DBs
NCBI-ProteinID: ANB65216
UniProt: A0A160FDF9
LinkDB All DBs
Position
3061178..3062269
Genome map
AA seq 363 aa AA seqDB search
MKTTIGVLYGGKSPEHKVSLQTAMAVMNAIDQTKFDVIPIYITKEGQWVKGEKLTSPVQD
IKQLEMKPEAKEILPVALNQAPVSAISSERQEEETIDVIFPLLHGPNGEDGTVQGLLELL
NLPYVGNGVLASAVGMDKVIMKNLFAQAGLRQAKYVAFLRKEWTQDEKKAYDKVERELGY
PCFVKPANAGSSVGITKCKKREDLEAAFAEAFQYDRKIIIEEAIIGREVEIGVIGNDNPI
CSVVGEIVPKKEFYDYQAKYEDGNTELIIPADITEEQYQTIQQMAIAAFKALDLSGLVRA
DFFLAADGTVYINEINTMPGFTPFSMFPLLWKHTGVSYSELIEKLVQLAMERHEEKQTIT
YTF
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaagacaaccattggcgtcttatacggcgggaaatcgcctgaacataaagtatcactg
caaacagctatggcggtgatgaatgctattgatcaaacaaaattcgatgtcattcccatt
tatatcaccaaagagggacaatgggtcaaaggagaaaaactgacaagtcctgttcaagac
ataaagcagttggaaatgaagccagaggcaaaagaaattttgcctgtcgctttaaatcaa
gcgccagtttcagcaatcagcagcgagcgtcaggaggaagaaaccattgatgtgattttt
cctctgctgcatggaccaaatggcgaagacggaacggtgcaaggcttgcttgagctatta
aaccttccttatgtagggaatggcgtgctagcgtcagcagtgggaatggataaagtcatt
atgaagaacttatttgcgcaagctggactgcgtcaagcgaagtatgtagcgtttttgaga
aaagagtggacgcaagatgaaaaaaaggcttatgataaagtagaaagagagcttggttac
ccttgctttgtcaagccagctaacgccggatcgagcgtgggcatcacgaaatgcaaaaaa
cgcgaagatctcgaagcagctttcgctgaagcgtttcagtatgatcgcaaaattattata
gaggaagccattatcggtcgtgaagtagaaatcggagttattggaaatgataacccaata
tgctctgtagttggcgaaattgttccgaaaaaggaattctacgattatcaagctaaatat
gaggacggaaataccgaacttattattcctgctgatattacagaagagcaatatcaaacc
attcaacaaatggcgattgccgctttcaaagcacttgatctttcgggacttgtaagggct
gatttctttttagcggcagacggaacagtatatattaacgagatcaatacaatgccgggg
tttactccatttagcatgttcccgcttctttggaagcacactggcgtttcttattcagag
ctgattgaaaagctcgttcagctggcgatggagcggcatgaagaaaagcaaacgatcacc
tatacgttttaa

DBGET integrated database retrieval system