KEGG   Anoxybacillus sp. B2M1: GFC28_1781Help
Entry
GFC28_1781        CDS       T04370                                 

Gene name
fabI
Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase [NADH]
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
anm  Anoxybacillus sp. B2M1
Pathway
anm00061  Fatty acid biosynthesis
anm00780  Biotin metabolism
anm01100  Metabolic pathways
anm01130  Biosynthesis of antibiotics
anm01212  Fatty acid metabolism
Module
anm_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:anm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    GFC28_1781 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    GFC28_1781 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    GFC28_1781 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:anm01004]
    GFC28_1781 (fabI)
Enzymes [BR:anm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     GFC28_1781 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     GFC28_1781 (fabI)
Lipid biosynthesis proteins [BR:anm01004]
 Fatty acid synthase
  Component type
   GFC28_1781 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: ANB55888
LinkDB All DBs
Position
complement(1789916..1790692)
Genome map
AA seq 258 aa AA seqDB search
MTLSLKGRTYVVMGVANKRSIAWGIARSLHAAGARLIFTYAGERFEAEVRKLVETLEDET
ALLLPCDVTNDEDIVKCFADIKEKVGVIHGVAHCIAFANKEDLSGEYMNVSREGFLLAHN
ISAYSLTAVAREAKALMTEGGSIVTLTYLGGERVVQNYNIMGVAKASLDASVKYLANDLG
PYGIRVNAISAGPIRTLSAKGVSDFNSILKEIEEKAPLRRTTTQEEVGDAALFLFSDLSR
GVTGECIHVDSGYHILAR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgacgttatcattaaaaggtcgcacatatgtcgtgatgggagtggcgaataaacgaagc
attgcgtggggaattgcccgttcgcttcacgcagcaggcgcccggctgatttttacctat
gcgggagagcgttttgaggcggaagtgcgcaaattagttgaaacgcttgaagatgagacc
gctttgttgcttccttgcgatgtgacaaatgatgaggacattgtcaaatgctttgcagac
atcaaagaaaaagtgggtgtcatccacggagtagcgcattgcattgcatttgccaacaaa
gaagatttaagcggcgaatacatgaatgtaagccgtgaaggatttttgttagcgcataat
attagcgcttattcattaacggctgtcgcaagagaagcaaaagcgcttatgactgaaggc
ggaagcattgttacgttgacgtatcttggcggcgagcgcgttgtacaaaactataatatc
atgggtgttgccaaagcttcattagatgcgagtgtcaaatatttagcgaacgatttaggc
ccatacggtattcgtgtcaacgcgatctctgctgggccgattcgcacattatcagcaaaa
ggggtcagcgatttcaactctattttaaaagaaatcgaagagaaagccccgcttcgccgg
acaacaacacaagaggaagtaggagatgcggcgctgttcttgttcagcgatttgtctcgc
ggtgttaccggcgaatgcattcatgtcgattccggctatcatattttggcccgttaa

DBGET integrated database retrieval system