KEGG   Anoxybacillus sp. B2M1: GFC28_2394Help
Entry
GFC28_2394        CDS       T04370                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
anm  Anoxybacillus sp. B2M1
Pathway
anm00473  D-Alanine metabolism
anm01100  Metabolic pathways
anm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:anm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    GFC28_2394 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    GFC28_2394 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:anm01011]
    GFC28_2394 (alr)
Enzymes [BR:anm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     GFC28_2394 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:anm01011]
 Precursor biosynthesis
  Racemase
   GFC28_2394 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ANB57111
LinkDB All DBs
Position
complement(2390061..2391230)
Genome map
AA seq 389 aa AA seqDB search
MIHSFHRDTWAEVDLDAIFHNVTSLRAFLGEQTEIMAVVKANAYGHGDVQVARTALEAGA
SYLAVAFLDEALALRKKGVGAPILVLGAVRPEDINLAAREQITLTVFQKEWLEKAKNLFT
EKQPVSFHLKMDTGMGRIGVKEEEETKQIVAMIEEHPFFLLEGVYTHFATADELDTQYFS
FQYEKFLRMLEWLPYLPKRVHCGNSATSLRFPDKVFNMVRFGIAMYGLSPSIDMKPLLPF
SLKEAFSLHSRIVHVKCLRPGEKVSYGATYTAEEEEWIGTVPIGYADGWIRKLQNFHVLV
NGRKVPIVGRICMDQMMIRLPEQVPVGTKVTLIGKQEAAQVTIDDVAKYVGTISYEIPCT
ISYRVPRIFLKKKSIMEVRNVVLDGNGCS
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgatacattcgtttcatagagacacttgggcggaagtcgatttggatgctattttccat
aacgttacgtcattgcgcgcctttttaggagagcagacagaaattatggctgttgtgaaa
gcgaatgcgtatgggcatggcgatgtccaagtggccagaaccgcgttggaagcgggggct
tcgtatttggccgtagcttttttagatgaagcgcttgcgctgcgaaaaaaaggagtgggc
gccccgatccttgtattaggcgcggttcgccctgaagacattaacttagccgctcgcgaa
caaattacgctcaccgtatttcagaaagaatggctggaaaaagccaaaaatttgtttaca
gagaaacagccggtttcttttcatttaaaaatggataccggaatgggcagaattggcgtg
aaagaggaagaagaaacaaaacaaattgttgcgatgattgaagagcatccgtttttttta
ttagaaggagtatacacccattttgccactgccgatgaattagatacacaatacttttca
tttcaatacgagaaatttttacgcatgcttgaatggctcccttatttgccaaagcgggtc
cattgtggaaacagcgcgacaagcttgcgcttccctgataaagtattcaatatggttcgt
ttcgggattgcgatgtatggtttgtctccttcgatagacatgaagccgctcttgcctttt
tcattaaaggaagcgttttcgctccatagccgcattgttcatgtaaaatgcttgcgccca
ggggaaaaagtgagctacggcgccacctatacagcggaagaggaagaatggattggaacg
gtgccgattggatatgcagacggatggatcagaaaattgcaaaacttccatgtgctcgta
aatggaagaaaggtgccgattgtagggcggatttgcatggatcaaatgatgattcgtctg
ccggaacaagtaccggttggcacgaaagtcacattgatcggcaagcaagaagctgctcag
gtaacaatagatgatgtggccaagtatgtaggaacgatcagctacgagatcccttgtaca
ataagttatcgcgttccccgtatttttttaaaaaagaagagtataatggaagtgagaaat
gttgttttagatggcaacggctgctcataa

DBGET integrated database retrieval system