KEGG   Anoxybacillus sp. B2M1: GFC28_2799Help
Entry
GFC28_2799        CDS       T04370                                 

Definition
(GenBank) thymidine kinase family protein
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
anm  Anoxybacillus sp. B2M1
Pathway
anm00240  Pyrimidine metabolism
anm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:anm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    GFC28_2799
Enzymes [BR:anm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     GFC28_2799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK UvrD-helicase AAA_14 IMPDH AAA_19
Motif
Other DBs
NCBI-ProteinID: ANB56014
LinkDB All DBs
Position
2782571..2783197
Genome map
AA seq 208 aa AA seqDB search
MDVMKQSGWLEVICGSMFSGKSEELIRRVRRATFAKQEVKVFKPAIDNRYSEEAVVSHNG
ASVIAISVATAEEILEYISEKTDVVAIDEVQFFDEQIVEIVQTLADRGYRVIAAGLDQDF
RGEPFGPVPTLMAIAESVTKLQAVCTVCGSPASRTQRLINGKPASYYDPVILVGASESYE
PRCRHHHEVPDKPKKRDRNGSETERIIR
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggatgtaatgaaacaatcaggctggctcgaggtgatttgcggcagcatgttctctgga
aaatcagaggagctgatccgccgcgttcgtcgtgctacatttgcaaagcaggaagtgaag
gtatttaaacctgcgattgataaccgctatagcgaagaagcggttgtatctcataatggc
gcttcagtgattgctatttccgtcgcgactgctgaggaaatattagaatacatatcagaa
aaaacggatgtcgttgccattgatgaagtgcaattttttgatgagcaaattgtcgaaatt
gtgcaaacgttagcagatcgcggttatcgcgtcattgcagctggattggatcaggatttt
cgcggtgaaccatttggtcctgtgccgacattaatggcgattgccgaatcggtcacaaag
cttcaagcagtatgtacggtatgcggttccccagcaagccgtacacagcgactcattaat
ggcaaacctgcttcttattatgatccggtgattttagtgggggccagtgaatcatatgag
ccgcgttgccgccatcatcatgaagttcctgataagccaaagaagcgagaccgtaatgga
agcgaaaccgaacgtatcattcggtag

DBGET integrated database retrieval system