KEGG   Anoxybacillus sp. B2M1: GFC28_2886Help
Entry
GFC28_2886        CDS       T04370                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
anm  Anoxybacillus sp. B2M1
Pathway
anm00010  Glycolysis / Gluconeogenesis
anm00620  Pyruvate metabolism
anm01100  Metabolic pathways
anm01110  Biosynthesis of secondary metabolites
anm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:anm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GFC28_2886
   00620 Pyruvate metabolism
    GFC28_2886
Enzymes [BR:anm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     GFC28_2886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ANB56264
LinkDB All DBs
Position
complement(2867561..2869081)
Genome map
AA seq 506 aa AA seqDB search
MIYTQPGHPGSLITFKKRYENFIGGKWVPPVDGEYFENISPVTGQPYCEVPRSKAADIEL
ALDAAHEAKEAWGRTSVTERARILNKIADRMEENLEMLAVAETWENGKPVRETLAADIPL
AIDHFRYFAGCIRAQEGSLAEIDNDTVAYHFKEPLGVVGQIIPWNFPILMAAWKLAPALA
AGNCVVLKPAEQTPTSILVLIELIEDLLPKGVVNVVNGFGLEAGKPLASNPRIAKVAFTG
ETTTGRLIMQYASQNIIPVTLELGGKSPNIFFADVAEQDDEFFDKALEGFTMFALNQGEV
CTCPSRALIQESIYDTFMERALERVKQIKQGNPLDTETMIGAQASSEQLEKILSYIDIGK
QEGADLLIGGERNFLEGELRNGYYVKPTVFKGHNKMRIFQEEIFGPVVSVTTFKDKEEAL
AIANETLYGLGAGVWTRDVNTAYRFGRGIQAGRVWTNCYHAYPAHAAFGGYKMSGIGRET
HKMMLEHYQQTKNLLVSYSPQKLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgatttatactcagcctggacaccctggttctctcatcacgtttaaaaaacgctatgaa
aactttattggcggcaaatgggtgcctccggtcgacggggaatatttcgaaaacatttct
ccagtgactggacagccgtattgcgaggtgcctcgttcgaaagcagctgatatcgagttg
gctttagacgcggcccatgaagcaaaggaagcgtggggccgcacatcggtcacggaacgg
gcccgcatcttaaacaaaattgctgaccgcatggaagaaaatctggaaatgctggcggtt
gccgaaacgtgggaaaacggcaaacccgtccgcgaaacactcgcggccgatattccgctc
gccattgaccatttccgctattttgctggctgcattcgcgctcaagaaggatcgcttgca
gaaatcgacaatgatacagttgcttatcactttaaagagccgcttggggtcgtcggacaa
atcatcccttggaatttcccgattttaatggcggcatggaagttggcaccagcactggcg
gcaggaaactgcgtcgtattaaaaccagcagaacaaacaccaacatccatcctcgtattg
attgaactcatcgaagatcttctaccaaaaggagtcgtcaacgttgtcaacggctttggg
ctcgaagcaggaaaaccgctcgcctccaatcctcgcattgccaaagtggcattcacaggc
gagacgacaacgggccggctcattatgcaatacgcatcgcaaaacatcatcccagttaca
cttgagcttggcggcaaatcaccaaacattttctttgccgatgtggctgaacaagacgat
gaattttttgataaagcgcttgaaggctttacgatgtttgctctcaatcagggcgaagtg
tgtacatgcccatctcgcgccctcattcaagaatccatttatgacacctttatggagcgg
gcgttagagcgagtcaaacaaattaagcaaggcaatccgctcgataccgaaacaatgatc
ggcgctcaagcgtcttccgagcaactagaaaaaatcctatcctatattgatattggaaag
caggaaggagccgatctgctcatcgggggagagcgcaatttcttggaaggcgaattacgc
aatggatattatgtcaaaccaaccgttttcaaaggccacaataaaatgcgcattttccaa
gaggaaatttttggaccagtcgtatctgtgacgacattcaaagacaaagaggaagcgctc
gccatcgccaatgaaacattgtatggtcttggcgctggtgtttggacgcgcgacgtcaac
actgcttaccgctttggacgtggcattcaggctggacgcgtctggacgaactgctaccac
gcctacccagctcacgctgcatttggcggatacaaaatgtccggtatcggacgcgaaacg
cacaaaatgatgcttgagcattatcaacaaaccaaaaatctgcttgtcagctattcgcct
caaaaacttggattcttttaa

DBGET integrated database retrieval system