KEGG   Anoxybacillus sp. B2M1: GFC28_3038Help
Entry
GFC28_3038        CDS       T04370                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
anm  Anoxybacillus sp. B2M1
Brite
KEGG Orthology (KO) [BR:anm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GFC28_3038 (ahpF)
Enzymes [BR:anm01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     GFC28_3038 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like DAO FAD_oxidored FAD_binding_3 AlaDh_PNT_C Thi4 NAD_binding_7 Glutaredoxin NAD_binding_8 Thioredoxin_4 K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: ANB57048
LinkDB All DBs
Position
3032762..3034291
Genome map
AA seq 509 aa AA seqDB search
MILDAEIKAQLAQYLQLMEGDVLLKVSAGSDSVSRDMLALVDELATMSPKIKVENTQLER
TPSFSVNRIGEDTGITFAGVPLGHEFTSLVLALLQTSGRPPKVDQKVIERIKNIKGTYHF
ESYVSLTCHNCPDVVQALNLMSILNPGISHTMIDGAAFKDEAESKGIMAVPTVFLNGELF
GSGRMSLEEILSKIGSTLDASAFAEKEPFDVLVVGGGPAGATAAIYAARKGIRTGIVAER
FGGQILDTLGIENFISVKYTEGPKLAASLEEHVKQYDIDIMDSQRVKRLEKKDLIEIELE
NGAVLKSKTVVLATGARWRNLGVPGEAEFKNKGVAYCPHCDGPLFEGKHVAVIGGGNSGV
EAAIDLAGIVKHVTVFEFMPELKADAVLQERLYSLPNVTVLKNVQTKEITGTDRVNGISY
IDRETGEEHHLELQGVFVQIGLVPNTDWLEGTVERNRFGEIIVDKRGATNIPGVFAAGDC
TDSAYKQIIISMGSGATAALGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgatattggatgcagaaataaaagcacagctggcccaatatctgcaattgatggaagga
gacgtacttcttaaagtcagcgcgggatccgatagcgtatcccgcgatatgctggctctt
gtggatgaattggccaccatgtctcctaaaatcaaagtagagaacacacagctagagaga
acgccaagctttagtgtgaatcgcatcggcgaagacacagggatcacatttgccggcgtt
ccattgggccatgagtttacttcattggtgttggctctactccagacaagtggaagacct
ccaaaagtcgatcagaaagtaattgaacgaattaaaaacataaaaggcacctatcatttt
gaatcttatgtgagcttgacatgccataactgccctgacgttgtacaagccttgaattta
atgagcatcctgaatcctggcatttcgcatacgatgattgacggtgcagcgtttaaggat
gaggcagaaagcaaggggattatggccgttccgactgtattcttaaatggagaacttttt
ggcagcggacggatgtcgcttgaagaaattctttcaaagataggaagcactttggatgcc
tccgctttcgctgaaaaagaaccatttgatgtgcttgttgtcggtggcggtccagctggc
gcaacggcagcgatttatgcagcgcgaaaaggcattcgcacgggtattgtagctgaacgc
tttgggggacaaatattggatacgttgggcattgagaactttatcagtgtcaaatataca
gaaggccctaagcttgcagcgagtcttgaggagcatgtcaaacagtatgatatcgatatc
atggattcgcagcgagtgaagcgcttagaaaagaaagatcttattgaaatcgagcttgaa
aatggcgcggttttaaaaagcaagacagtggttttggcaacaggcgctcgctggcgcaat
cttggggtgccaggtgaggctgagttcaaaaacaaaggagtggcctactgccctcattgc
gacggtccgttgtttgaaggaaagcatgtggccgttattggaggcggcaattccggcgta
gaggcagcgattgatcttgccggtattgtcaagcatgtcaccgtctttgaatttatgccg
gaattaaaagctgatgccgttcttcaagagcgcctctacagtttgcctaatgtcaccgtt
cttaagaacgtccaaacaaaggaaattaccggtacagaccgagtaaacggcatttcttac
attgaccgcgaaacaggtgaagagcatcaccttgaattacaaggcgtattcgtgcagatt
ggccttgtgccaaataccgattggttagagggaactgttgagcgcaaccgcttcggcgaa
attatcgtcgataagcgaggggctacgaacatccctggcgtatttgcggcaggcgactgc
acagatagtgcatataagcagatcattatttcgatgggatcaggcgcgaccgccgctttg
ggcgcatttgattacctcattcgaaattaa

DBGET integrated database retrieval system