KEGG   Anoxybacillus sp. B2M1: GFC28_3411Help
Entry
GFC28_3411        CDS       T04370                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
anm  Anoxybacillus sp. B2M1
Pathway
anm00010  Glycolysis / Gluconeogenesis
anm00030  Pentose phosphate pathway
anm00051  Fructose and mannose metabolism
anm00052  Galactose metabolism
anm00680  Methane metabolism
anm01100  Metabolic pathways
anm01110  Biosynthesis of secondary metabolites
anm01120  Microbial metabolism in diverse environments
anm01130  Biosynthesis of antibiotics
anm01200  Carbon metabolism
anm01230  Biosynthesis of amino acids
anm03018  RNA degradation
Module
anm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
anm_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:anm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GFC28_3411 (pfkA)
   00030 Pentose phosphate pathway
    GFC28_3411 (pfkA)
   00051 Fructose and mannose metabolism
    GFC28_3411 (pfkA)
   00052 Galactose metabolism
    GFC28_3411 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    GFC28_3411 (pfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    GFC28_3411 (pfkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:anm01009]
    GFC28_3411 (pfkA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:anm03019]
    GFC28_3411 (pfkA)
Enzymes [BR:anm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GFC28_3411 (pfkA)
Protein phosphatases and associated proteins [BR:anm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GFC28_3411 (pfkA)
Messenger RNA biogenesis [BR:anm03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     GFC28_3411 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: ANB56197
LinkDB All DBs
Position
3402954..3403913
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIYHGLEVFGIYHGYAGLIEGKIKKLEIGDVGDI
IHRGGTMLYTARCPEFKTLEGQLKGIEQLQKHGIEGLVVIGGDGSYQGAKKLTEHGYPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLAGGAESILIPEADYDMNDIVARLKRGHERGKKHSIIIVAEGVGSGVEFGSKIQEATGF
ETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGQGGRCVGIQNNQLVDHDIIEAL
SHKHTIEPKMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagagaataggtgtgttaacaagcggcggcgattcaccaggaatgaatgcggcgatt
cgtgcagttgtgcgtaaagccatttatcacggattagaggtttttggtatttaccacggg
tacgcaggactcattgaaggaaaaattaagaaactagaaatcggcgatgtaggggatatt
attcatcgcggaggaacgatgctttataccgcacgctgcccggaatttaaaacacttgag
ggacaactaaaaggaattgaacagttgcaaaagcatggaatcgaagggctggttgttatt
ggcggagacggttcctatcaaggggcaaaaaagcttaccgaacacggatacccatgtgta
ggggtgccgggaacaatcgataatgatatacctggaacggattttacaatcggttttgat
acagcgttaaataccgtgattgatgcaatcgacaaaattcgtgatacagctacctctcat
gaacgcacatatgtgattgaagtcatgggacgtcatgctggcgatatcgcgctttgggcg
gggctggcaggcggtgctgaatcgattttaatcccagaagcagactatgatatgaatgat
atcgtcgcccgtttaaaacgaggacatgaacgcgggaaaaaacatagtattattattgtc
gcagaaggcgtcggaagcggagtcgaattcggcagcaaaattcaagaggcgaccgggttt
gaaacgcgtgtaacggtattgggacatgtacagagaggcggttctccgaccgcattcgat
cgcgtattagcaagccgtttaggagcgcgcgcagtcgagctgctgcttgaaggacaaggg
ggccgctgtgtcggcattcaaaataatcagctagtggatcacgatatcatcgaagcatta
tcgcacaagcatacgattgagccaaaaatgtaccaattgtcaaaagaactttccatctag

DBGET integrated database retrieval system