KEGG   Anoxybacillus sp. B2M1: GFC28_3417Help
Entry
GFC28_3417        CDS       T04370                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
anm  Anoxybacillus sp. B2M1
Pathway
anm00020  Citrate cycle (TCA cycle)
anm00480  Glutathione metabolism
anm01100  Metabolic pathways
anm01110  Biosynthesis of secondary metabolites
anm01120  Microbial metabolism in diverse environments
anm01130  Biosynthesis of antibiotics
anm01200  Carbon metabolism
anm01210  2-Oxocarboxylic acid metabolism
anm01230  Biosynthesis of amino acids
Module
anm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
anm_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:anm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GFC28_3417 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    GFC28_3417 (icd)
Enzymes [BR:anm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     GFC28_3417 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ANB57023
LinkDB All DBs
Position
3409651..3410925
Genome map
AA seq 424 aa AA seqDB search
MVQGEKITVTNGVLNVPNNPIIPFIEGDGTGPDIWAAASRVLEAAVEKAYKGEKKIAWKE
VLAGEKAYKLTGEWLPQETLDVIREYIIAIKGPLTTPVGGGIRSLNVALRQELDLFVCLR
PVRYFNGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGTEEVKKVIHFLQNEMGVRKIR
FPETSGIGIKPISEEGTKRLVRAAINYAIEHGRKSVTLVHKGNIMKFTEGAFKNWGYELA
EQEFGDKVFTWAEYDRIVEAEGKEAANKAQAEAEAAGKIIVKDAIADIFLQQILTRPREF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVMMFEHLGWNEAAKLIIESMEKTIASKVVTYDFARLMEGATEVKCSEFADALIR
NMGE
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
gtggttcaaggtgaaaaaattacagtcacaaacggtgtgttaaacgtaccaaacaatccg
attatccctttcattgaaggtgatgggacaggccctgatatttgggcggcagcctcccgc
gtgctagaagctgcggttgaaaaagcctataaaggagaaaagaaaattgcttggaaagaa
gttcttgctggcgaaaaagcatataagctaacgggagaatggctgcctcaagaaacgttg
gatgtgattcgcgaatacataattgccattaaaggcccattaacgacccctgtcggcgga
gggattcgttcattgaatgtcgcgcttcgtcaagagcttgatttgtttgtttgcttgcgc
ccagtccgttacttcaatggcgtgccttctccagtgaaacgtcctgaagatacggatatg
gttattttccgtgaaaatacagaagatatttatgccggaattgagtatgccaaaggcact
gaagaagtgaaaaaagtgattcactttttgcaaaatgaaatgggcgttcgtaaaattcgc
ttcccggaaacatctggtatcggtattaagccgatttccgaggagggaactaaacgtctc
gttcgagcagccatcaactatgctatcgagcacggccgcaagtctgttacgctcgtacat
aaaggaaacattatgaaatttacggaaggcgcatttaaaaactggggctatgagcttgca
gagcaagaatttggagataaagtctttacatgggcggaatatgatcgcatcgttgaagcg
gaaggaaaagaggctgcaaataaagctcaggctgaagcggaagcagcaggaaaaattatc
gttaaagatgcgattgctgatattttcttgcaacaaattttaacgcgtccacgtgagttt
gatgttgtcgcgactatgaatttgaacggtgactatatttcagatgccttggcagctcaa
gtaggaggtattggcattgctccaggtgcaaatattaactatgaaacagggcatgccatc
tttgaagcgactcatggcacggctccaaaatatgcaggattagacaaagtaaatccatcc
tctgttattttgtcaggcgtcatgatgtttgagcaccttggctggaatgaagcggctaag
ctgattattgaatccatggagaaaacaattgcttcgaaagtcgtcacctacgatttcgcc
cgtctgatggaaggagcaacagaagtgaagtgctctgagtttgctgatgcattgatccgt
aatatgggagaataa

DBGET integrated database retrieval system